KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0408Help
Entry
NMB0408           CDS       T00027                                 

Gene name
bacA
Definition
(RefSeq) undecaprenyl pyrophosphate phosphatase
  KO
K06153  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0408 (bacA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     NMB0408 (bacA)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Diphosphatase
   NMB0408 (bacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
415186..416007
Genome map
AA seq 273 aa AA seqDB search
MDFLIVLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVF
EYRQRFSNVLHGLGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFNPLSVAVMLVL
GGFFILWVEKRQSRAEPKIADVDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGI
ERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHDVGLILIGFIAAFVSGLVAVKALLR
FVSKKNYIPFAYYRIVFGIAIIILWLSGWISWE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggattttctgattgtcctgaaagccctgatgatgggcttggtagaaggttttaccgaa
tttttaccgatttccagcaccggacatttgattgtgttcggcaatctgattggttttcac
agcaatcacaaggtttttgaaattgccatccagctcggtgcagttttggcggtagtgttt
gaataccggcaacgtttcagcaatgtgttgcacggcttgggaaaagaccggaaagccaac
cgcttcgtccttaatcttgccattgcttttatacctgccgccgtgatggggctgttgttc
ggcaaacaaatcaaagagtatctgtttaaccccttgagtgttgcagtcatgctggttttg
ggcggtttttttattttgtgggtggagaaacgccaaagccgagcagagcctaaaattgcc
gatgttgatgcattgcgtccgattgatgccttgatgatcggcgttgcccaagtgtttgca
ctggttccgggtacgtcccgttcgggcagtacgattatgggcgggatgctttggggcatc
gaacggaaaactgcgacagaattctcgtttttcttggctgtgccgatgatggttgccgca
acggcttatgatgtcctgaaacattaccgatttttcaccctgcatgatgtcggtttgatt
ctgataggctttattgctgcctttgtttcaggcttggtagcggtaaaagcgttgctgagg
tttgtttccaagaaaaattatattccttttgcctattaccgcattgtttttggtattgcc
atcattatattgtggctgtcaggctggataagttgggaatga

DBGET integrated database retrieval system