KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0413Help
Entry
NMB0413           CDS       T00027                                 

Gene name
penA
Definition
(RefSeq) penicillin-binding protein 2
  KO
K03587  
cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0413 (penA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NMB0413 (penA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMB0413 (penA)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NMB0413 (penA)
Chromosome [BR:nme03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    NMB0413 (penA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
419829..421574
Genome map
AA seq 581 aa AA seqDB search
MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQ
GDNRIVRTQTLPATRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELVDV
PVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIG
FTDIDGKGQEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLD
QRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNR
AVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQ
KSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSF
GYGLQLSLLQLARAYTALTHDGVLLPVSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEP
GGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA
HGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaagagcgaatataagcctcggatgctgcccaaagaagagcaggtcaaaaag
ccgatgaccagtaacggacggatcagcttcgtcctgatggcaatagcggtcttgtttgcc
ggtctgattgctcgcggactgtatctgcagacggtaacgtataactttttgaaagaacag
ggcgacaaccggattgtgcggactcaaacattgccggctacacgcggtacggtttcggac
cggaacggtgcggttttggcgttgagtgcgccgacggagtccctgtttgccgtgcctaaa
gagatgaaggaaatgccgtctgccgcacaattggaacgcctgtccgagcttgtcgatgtg
ccggttgatgttttgaggaacaagctcgaacagaaaggcaagtcgtttatctggattaag
cggcagctcgatcccaaggttgccgaagaggtcaaagccttgggtttggaaaactttgta
tttgaaaaagaattaaaacgccattacccgatgggcaacctgtttgcacacgtcatcgga
tttaccgatattgacggcaaaggtcaggaaggtttggaactttcgcttgaagacagcctg
catggcgaagacggcgcggaagtcgttttgcgggaccggcagggcaatattgtggacagc
ttggactccccgcgcaataaagccccgaaaaacggcaaagacatcatcctttccctcgat
cagaggattcagaccttggcctatgaagagttgaacaaggcggtcgaataccatcaggca
aaagccggaacggtggtggttttggatgcccgcacgggggaaatcctcgccttggccaat
acgcccgcctacgatcccaacaggcccggccgggcagacagcgaacagcggcgcaaccgt
gccgtaaccgatatgatcgaacccggttcggcaatcaaaccgtttgtgattgcgaaggca
ttggatgcgggcaaaaccgatttgaacgaacggctgaatacgcagccttataaaatcgga
ccgtctcccgtgcgcgatacccatgtttacccctctttggatgtgcgcggcatcatgcag
aaatcgtccaacgtcggcacaagcaaactgtctgcgcgtttcggtgccgaagaaatgtat
gacttctatcatgagttgggcatcggtgtgcgtatgcactcgggctttccgggcgaaact
gcaggtttgttgagaaattggcgcaggtggcggcctatcgaacaggcgacgatgtctttc
ggttacggcctgcaattgagcctgctgcaattggcgcgcgcctataccgcactgacgcac
gacggcgttttactgccggtcagctttgaaaaacaggcggttgcgccgcaaggcaaacgc
atattcaaagaatcgaccgcgcgcgaggtacgcaatctgatggtttccgtaaccgagccg
ggcggcaccggtacggcgggtgcggtggacggtttcgatgtcggcgcgaaaaccggcacg
gcgcgcaagttcgtcaacgggcgttatgccgacaacaaacacatcgctacctttatcggt
tttgcccccgccaaaaatccccgtgtgattgtggcggtaaccattgacgaaccgactgcc
cacggttattacggcggcgtagtggcagggccgcccttcaaaaaaattatgggcggcagc
ctgaacatcttgggcatttccccgaccaagccactgaccgccgcagccgtcaaaacaccg
tcttaa

DBGET integrated database retrieval system