KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0416Help
Entry
NMB0416           CDS       T00027                                 

Gene name
murF
Definition
(RefSeq) UDP-MurNAc-pentapeptide synthetase
  KO
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0416 (murF)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0416 (murF)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NMB0416 (murF)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     NMB0416 (murF)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Amino acid ligase
   NMB0416 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
424872..426239
Genome map
AA seq 455 aa AA seqDB search
MKPLDLNFICQALKLPMPSESKPVSRIVTDSRDIRAGDVFFALAGERFDAHDFVEDVLAA
GAAAVVVSREDCAAMDGALKVDDTLAALQTLAKAWRENVNPFVFGITGSGGKTTVKEMLA
AVLRRRFGDDAVLATAGNFNNHIGLPLTLLKLNEKHRYAVIEMGMNHFGELAVLTQIAKP
NAALVNNAMRAHVGCGFDGVGDIAKAKSEIYQGLCSDGIALIPQEDANMAVFKTATLNLN
TRTFGIDSGDVHAENIVLKPLSCEFDLVCGDERAAVVLPVPGRHNVHNAAAAAALALAAG
LSLNDVAEGLKGFSNIKGRLNVKSGIKGATLIDDTYNANPDSMKAAIDVLARMPAPRIFV
MGDMGELGELGEDEAAAMHAEVGAYARDQGIEAAYFVGDNSVEAAEKFGADGLWFAAKDP
LIQVLRHDLPERATVLVKGSRFMQMEEVVEALEDK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccactggacctaaatttcatctgccaagccctcaagcttccgatgccgtctgaa
agcaaacccgtgtcgcgcatcgtaaccgacagccgcgacatccgcgcgggcgatgtgttt
ttcgcattggcgggcgagcggtttgacgcgcatgattttgttgaagacgtattggctgct
ggtgcggcggcggttgtggtttcgcgcgaagattgtgctgcaatggatggcgcgttgaaa
gtcgatgacacgcttgccgcattgcaaacgctggcaaaggcgtggcgtgaaaatgtgaat
ccgtttgtgttcggcattaccggttcgggcggcaagacgacggtgaaggaaatgctggct
gcggtattgcgccgccgtttcggcgatgatgccgtgttggcgacggcaggcaacttcaac
aaccatatcggattgccgctgactttgttgaagttaaacgaaaaacaccgctatgccgtg
attgaaatgggcatgaaccatttcggcgaactggcggttttaacgcaaatcgccaaacca
aatgccgcattggtcaacaacgccatgcgcgcccatgtcggctgcggtttcgacggagtg
ggcgatattgccaaagcgaaaagcgagatttaccaaggtttatgttcagacggcattgca
ctgattcctcaagaagatgccaatatggctgtcttcaaaacggcaacgcttaatttgaat
acgcgcactttcggcatcgatagcggcgatgttcacgcggaaaatattgtgctgaaaccg
ttgtcgtgcgaatttgatttggtgtgcggcgatgagcgcgccgccgtggtgctgcctgtt
cccggccgccacaatgtccacaacgccgccgctgccgccgcgctggctttggctgcgggt
ttgagtttgaacgatgtggcggaaggtttgaaaggcttcagcaatatcaaaggccgtctg
aacgtcaaatccggaatcaagggcgcaaccctgattgacgatacttataatgcgaaccct
gacagcatgaaagctgcgattgacgtgttggcgcgtatgcctgcgccgcgtattttcgtg
atgggcgatatgggcgaactgggcgaactgggcgaggacgaagccgccgctatgcacgcc
gaagtcggcgcgtatgcccgcgaccaaggcatcgaagcggcttattttgtcggcgacaac
agcgtcgaagcggcggaaaaatttggcgcggacggtttgtggttcgccgccaaagacccg
ttgattcaagtgttgcgccacgatttgcccgaacgcgccaccgtgttggtgaaaggttcg
cgctttatgcagatggaagaagtggtcgaggcattggaggataagtga

DBGET integrated database retrieval system