KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0418Help
Entry
NMB0418           CDS       T00027                                 

Gene name
mraY
Definition
(RefSeq) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  
phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0418 (mraY)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NMB0418 (mraY)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     NMB0418 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Glycosyltransferase
   NMB0418 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
426665..427747
Genome map
AA seq 360 aa AA seqDB search
MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDG
PQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRKVV
YKDPNGVSAKFKMVWQSSVAIIASLALFYLAANSANNILIVPFFKQIALPLGVVGFLVLS
YLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVAGANEVV
IFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMGGLFVVE
AVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGLSTLKIR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttttatggctcgcacatttcagcaactggttaaccggtctgaatatttttcaatac
accacattccgcgccgtcatggcggcgttgaccgccttagcgttttccctgatgttcggc
ccgtggacgatacgcaggctgaccgcgctcaaatgcgggcaggcagtgcgtaccgacggt
ccgcaaacccacctcgtcaaaaacggcacgccgacgatgggcggttcgctgattctgacc
gccattaccgtgtccaccctgttgtggggcaactgggcaaacccgtatatctggattctc
ttgggcgtattgctcgccacgggcgcactcggtttttacgacgactggcgcaaagtcgtc
tataaagaccccaacggcgtgtccgccaaattcaaaatggtgtggcagtcaagcgttgcc
attatcgccagtttggcattgttttaccttgccgccaattccgccaacaatattttgatt
gtcccgttcttcaaacaaatcgccctgccgctgggcgtggtcggctttttggtgttgtct
tacctgaccatcgtcggcacatccaatgccgtcaacctcaccgacggcttggacggcctt
gcgaccttccccgtcgtcctcgttgccgccggcctcgccatcttcgcctatgccagcggc
cactcacaatttgcccaatacctgcaattaccttacgttgccggcgcaaacgaagtggtg
attttctgtaccgccatgtgcggcgcgtgcctcggtttcttgtggtttaacgcctatccc
gcgcaagtctttatgggcgatgtcggtgcattggcattgggtgccgcgctcggtaccgtc
gccgttatcgtccgccaagagtttgtcctcgtcattatgggcggattatttgtcgtagaa
gccgtatccgttatgcttcaggttggctggtataagaaaaccaaaaaacgcatcttcctg
atggcgcccatccatcaccactacgaacaaaaaggctggaaagaaacccaagtcgtcgtc
cgcttttggattattaccatcgtcttggtgttgatcggtttgagtaccctcaaaatccgc
tga

DBGET integrated database retrieval system