KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0430Help
Entry
NMB0430           CDS       T00027                                 

Gene name
prpB
Definition
(RefSeq) 2-methylisocitrate lyase
  KO
K03417  
methylisocitrate lyase [EC:4.1.3.30]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NMB0430 (prpB)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.30  methylisocitrate lyase
     NMB0430 (prpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
440420..441298
Genome map
AA seq 292 aa AA seqDB search
MMSQHSAGARFRQAVKESNPLAVAGCVNAYFARLATQSGFKAIYLSGGGVAACSCGIPDL
GITTMEDVLIDARRITDNVDTPLLVDIDVGWGGAFNIARTIRNFERAGVAAVHIEDQVAQ
KRCGHRPNKAIVSKDEMVDRIKAAVDARVDENFVIMARTDALAVEGLDAAIERAQACVEA
GADMIFPEAMTDLNMYRQFADAVKVPVLANITEFGSTPLYTQSELAENGVSLVLYPLSSF
RAASKAALNVYEAIMRDGTQAAVVDSMQTRAELYEHLNYHAFEQKLDKLFQK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcaacactctgccggagcacgtttccgccaagccgtgaaagaatcgaatccg
cttgccgtcgccggttgcgtcaatgcttattttgcacgattggccacccaaagcggtttc
aaagccatctatctgtccggcggcggcgtggcagcctgttcttgcggtatccctgatttg
ggcattaccacaatggaagatgtgctgatcgacgcacgacgcattacggacaacgtggat
acgcctctgctggtggacatcgatgtgggttggggcggtgcattcaatattgcccgtacc
attcgcaactttgaacgcgccggtgttgcagcggttcacatcgaagatcaggtagcgcaa
aaacgctgcggccaccgtccgaacaaagccattgtatctaaagatgaaatggtcgaccgt
atcaaagctgccgtagatgcgcgcgttgatgagaacttcgtgattatggcgcgtaccgat
gcgctggcggtagaaggtttggatgccgctatcgaacgcgcccaagcttgtgtcgaagcc
ggtgcggacatgattttccctgaagccatgaccgatttgaacatgtaccgccaatttgca
gatgcggtgaaagtgcccgtgttggcgaacattaccgagtttggttccactccgctttat
acccaaagcgagctggctgaaaacggcgtgtcgctggtgctgtatccgctgtcatcgttc
cgtgcagcaagcaaagccgctctgaatgtttacgaagcgattatgcgcgatggcactcag
gcggcggtggtggacagtatgcaaacccgtgccgagctgtacgagcatctgaactatcat
gccttcgagcaaaaactggataaattgtttcaaaaatga

DBGET integrated database retrieval system