KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0435Help
Entry
NMB0435           CDS       T00027                                 

Gene name
ackA-1
Definition
(RefSeq) acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0435 (ackA-1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0435 (ackA-1)
   00640 Propanoate metabolism
    NMB0435 (ackA-1)
  Energy metabolism
   00680 Methane metabolism
    NMB0435 (ackA-1)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB0435 (ackA-1)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NMB0435 (ackA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
448549..449748
Genome map
AA seq 399 aa AA seqDB search
MSDQLILVLNCGSSSLKGAVIDRKSGSVVLSCLGERLTTPEAVITFNKDGNKRQVPLSGR
NCHAGAVGMLLNELEKHGLHDRIKAIGHRIAHGGEKYSESVLIDQAVMDELNACIPLAPL
HNPANISGILAAQEHFPGLPNVGVMDTSFHQTMPERAYTYAVPRELRKKYAFRRYGFHGT
SMRYVAPEAARILGKPLEDIRMIIAHLGNGASITAIKNGKSVDTSMGFTPIEGLVMGTRC
GDIDPGVYSYLTSHAGMDVAQVDEMLNKKSGLLGISELSNDCRTLEIAADEGHEGARLAL
EVMTYRLAKYIASMAVGCGGVDALVFTGGIGENSRNIRAKTVSYLDFLGLHIDTKANMEK
RYGNSGIISPTDSSPAVLVVPTNEELMIACDTAELAGIL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccaactcatcctcgttctgaactgcggcagttcatcgctcaaaggcgccgtt
atcgaccgaaaaagcggcagcgtcgtcctaagctgcctcggcgaacgcctgaccacgccc
gaagccgtcattacgttcaacaaagacggcaacaaacgccaagttcccctgagcggccga
aattgccacgccggcgcggtgggtatgcttttgaacgaactggaaaaacacggtctgcac
gaccgcatcaaagccatcggccaccgcatcgcccacggcggcgaaaaatacagcgagtct
gttttgatcgaccaggccgtaatggacgaactcaatgcctgcattccgcttgcgccgctg
cacaaccccgccaacatcagcggcatccttgccgcacaggaacatttccccggtctgccc
aatgtcggcgtgatggatacttcgttccaccaaaccatgccggagcgtgcctacacttat
gccgtgccgcgcgagttgcgtaaaaaatacgctttccgccgctacggtttccacggcacc
agtatgcgttacgttgcccctgaagccgcacgcatcttgggcaaacctctggaagacatc
cgcatgattattgcccacttaggcaacggcgcatccattaccgccatcaaaaacggcaaa
tccgtcgataccagtatgggtttcacgccgatcgaaggtttggtaatgggtacacgttgc
ggcgacatcgatccgggcgtatacagctatctgacttcccacgccgggatggatgttgcc
caagtggatgaaatgctgaacaaaaaatcaggtttgctcggtatttccgaactttccaac
gactgccgcaccctcgaaatcgccgccgacgaaggccacgaaggcgcgcgcctcgccctc
gaagtcatgacctaccgcctcgccaaatacatcgcttcgatggctgtgggctgcggcggc
gttgacgcactcgtgttcaccggcggtatcggcgaaaactcgcgtaatatccgtgccaaa
accgtttcctatcttgatttcttgggtctgcacatcgacaccaaagccaatatggaaaaa
cgctacggcaattcgggcattatcagcccgaccgattcttctccggctgttttggttgtc
ccgaccaatgaagaactgatgattgcctgcgacactgccgaacttgccggcatcttgtag

DBGET integrated database retrieval system