KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0440Help
Entry
NMB0440           CDS       T00027                                 

Definition
(RefSeq) prephenate dehydrogenase
  KO
K00210  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0440
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0440
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB0440
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     NMB0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(453095..453967)
Genome map
AA seq 290 aa AA seqDB search
MPILNHIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGVIDQASVAIDA
DSIGGADLVLIATPVATVPAILTALRPVLPEHTWISDVGSTKSSVIEAFRRCLPDRLHHC
IAAHPIAGSDRSGAQAAQFGLFRHRKLIITPHGGEHSDGIALVENLWHAVGAEIYTMDAQ
RHDAVFAAVSHMPHLTAFAYVHQILDHPDGQEYLKFAATGFRDFTRIASGHPAVWADICL
ANKDSLLQLVQGLGKQLDVLANILTTDDREALYRYFEEAKTTRDRWLDGN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccattttgaaccatattgccctcatcggtgtagggctgatcggcggttcgttcgtt
ctcgacctcaaaaggcagggactcgtccgcaccgttaccggtatcgacaccgaccgcgac
aacctcgaacgtgcattggaacgcggcgtgattgaccaggcttccgttgccatcgacgcg
gacagcatcggcggtgcggacttggtactgattgccacgcccgtcgccaccgttcccgcc
attttgaccgcgctgcgccccgttttgccggaacacacttggatttccgatgtcggcagc
accaaatcttcggtcatcgaagccttccgccgctgtctgcccgaccgcctgcaccactgc
atcgccgcccacccaattgccggttcggacagaagcggtgcgcaagccgcgcagttcggg
ctgttccgccacagaaaactcatcatcacgccacacggcggcgaacattcagacggcatt
gccttggtagaaaacctgtggcacgcggtcggtgcggaaatttatacgatggacgcgcaa
cgccacgacgcggttttcgccgccgtctcccatatgccccacctgaccgccttcgcctat
gtccaccagattctcgaccaccccgacggacaggaatatctgaaattcgccgccacgggc
tttcgggacttcacccgcatcgcctccggtcatcccgccgtgtgggcggacatctgcctt
gccaacaaagacagcctgctgcaactggttcaaggcttgggcaaacagttggacgttttg
gcaaacatcctgaccaccgacgaccgcgaagccctgtaccgctattttgaagaagccaaa
accacacgcgaccgctggctggacggcaactga

DBGET integrated database retrieval system