KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0446Help
Entry
NMB0446           CDS       T00027                                 

Gene name
pheA
Definition
(RefSeq) chorismate mutase
  KO
K14170  
chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Phenylalanine biosynthesis, chorismate => phenylalanine
Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0446 (pheA)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     NMB0446 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NMB0446 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
460670..461758
Genome map
AA seq 362 aa AA seqDB search
MSQTIDELLLPHRNAIDTIDAEILRLLNERAQHAHAIGELKGTGAVYRPEREVAVLRRIQ
DLNKGPLPDESVARLFREVMSECLAVERPLTIAYLGPQGTFTQQAAIKHFGHAAHTMACP
TIDDCFKQVETRQADYLVAPVENSTEGSVGRTLDLLAVTALQACGEIVLRIHHNLLRKNN
GSTEGIAKVFSHAQALAQCNDWLGRHLPNAERIAVSSNAEAARLVAESDDGTVAAIAGRT
AAEIYGLDMVAECIEDEPNNTTRFLVMGHHETGASGSDKTSLAVSAPNRAGAVASLLQPL
TESGISMTKFESRPSKSVLWEYLFFIDIEGHRRDAQIQTALERLGERASFVKVIGSYPTA
VL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaactatcgacgaactcctccttccccaccgcaacgccatcgacaccatcgat
gccgaaatcctgcgcctgctcaacgaacgtgcgcaacacgcccacgccatcggcgagctg
aaaggcacgggcgcagtgtaccgccccgaacgcgaagtcgccgtgttgcgccgcattcag
gatttgaacaaaggcccgctgcccgacgaatcggtagcacgcctgtttcgggaagtgatg
agcgagtgcctcgccgtcgaacgcccgctgaccatcgcctatctggggccgcagggcacg
tttacccagcaggcggcaatcaaacatttcggacacgccgcgcacaccatggcgtgtccg
accatagacgactgcttcaagcaggttgaaacgcgtcaggcggattatctggtcgccccc
gtggaaaattcgaccgaaggctcggtcggtcgcacgttagacctgcttgccgttaccgcg
ttgcaggcgtgcggcgaaatcgttttgcgcatccaccacaaccttttgcgtaaaaacaac
ggcagcaccgaaggcattgccaaagtcttttcccacgcgcaggcgttggcgcagtgcaac
gactggttgggcagacacctgcccaacgccgaacggattgccgtgtccagcaatgccgaa
gccgcaaggctggttgccgaatcggacgacggtacggttgccgccatcgccggacgcacg
gcggcggaaatctacggactcgatatggttgccgagtgcatcgaagacgaaccgaacaac
accacgcgcttcttggtgatgggacatcacgaaaccggtgcaagcggcagcgacaagact
tcgctggccgtttccgcgcccaaccgggcaggcgcggttgcctcgctgctgcaaccgctg
accgaatcgggtatttccatgaccaagtttgagagccgtccgagcaaatccgttttgtgg
gaatacctgttcttcatcgacatcgaaggacaccgccgggacgcgcagattcagacggca
ttggaacgcttgggcgaacgcgcttcgttcgtcaaagtcatcggttcgtacccgaccgcc
gttttgtag

DBGET integrated database retrieval system