KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0452Help
Entry
NMB0452           CDS       T00027                                 

Gene name
acpS
Definition
(RefSeq) 4'-phosphopantetheinyl transferase
  KO
K00997  
holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0452 (acpS)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     NMB0452 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
465399..465776
Genome map
AA seq 125 aa AA seqDB search
MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGKPVNYLAKRFAAKEAFA
KAVGTGIRGAVSFRNIGIGHDALGKPEFFYGPALSKWLEEQGISRVSLSMSDEEDTVLAF
VVAEK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatttacggcatcggcacagacattgtttccctcaagcgcatcatccgcttaaacaaa
aaattcggacaggcgtttgccgggcgcatcctcactccggaagagctgcttgaatttccg
caagcgggcaaacccgtcaactacctcgccaaacgctttgccgccaaagaagcctttgcc
aaagccgtcggcacgggcatacgcggcgcggtttccttccgcaacatcggcatcgggcat
gacgcattgggcaagcccgaatttttctacggccccgccctgtccaaatggctggaggaa
caaggcatcagccgcgtcagcctcagcatgagcgacgaagaagacaccgtattggcgttt
gtcgttgccgaaaaataa

DBGET integrated database retrieval system