KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0453Help
Entry
NMB0453           CDS       T00027                                 

Gene name
mutT
Definition
(RefSeq) pyrophosphohydrolase MutT
  KO
K03574  
8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     NMB0453 (mutT)
DNA repair and recombination proteins [BR:nme03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    NMB0453 (mutT)
 Prokaryotic Type
    NMB0453 (mutT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
465858..466667
Genome map
AA seq 269 aa AA seqDB search
MIQDTRPLIRVVAGILLDSDGNYLLSSRPEGKPYAGYWEFAGGKVEAGETDFQALQREFE
EELGIRILAATPWLTKIHSYEHARVCLKFLWVNPDQWTGKPQSREGQEWSWQKAGDFTVA
PMLPANGALLRSLSVPRRLYGSLKTGLHGENSMGAYRVLPLGSAEGSGANVLMEAAQWQD
RPEHADSVWMVVQTREQWRRAQEKGADAVVWRVCDDVQAQEAAEALRQGVSVPLVLAANG
QTVARYGKLWLGLGAHVVVRDETIGKNHE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagacacccgaccccttatccgcgtcgttgccggcatcctgctcgattcagac
ggcaactacctgctcagctcgcgccccgaaggcaaaccctatgccggatattgggaattt
gccggcggcaaggtcgaagcgggcgaaaccgacttccaagccctgcaacgcgagtttgaa
gaagaactcggcatccgcatcctcgccgccacgccttggttgaccaaaatccattcctac
gaacacgcccgcgtctgcctgaaattcctatgggtcaaccccgaccaatggacgggcaaa
ccgcaatcccgcgaagggcaggaatggtcttggcagaaggcgggtgattttaccgttgcc
cccatgctgcccgccaacggcgcgcttttgcgttcgctgtccgtcccgcgccgtttgtac
ggcagcctgaaaacgggtttgcacggagaaaacagtatgggcgcgtaccgcgtcctgcct
ttgggttcggcagagggaagcggtgcgaacgttttgatggaggcggcgcaatggcaggac
agacccgaacacgccgacagcgtgtggatggtggtgcagacccgcgaacaatggcggcgg
gcgcaggaaaagggcgcggatgcggtcgtttggcgcgtgtgcgatgatgttcaggcacaa
gaggcggcagaagccctgcggcagggcgtatccgtgccgctcgtacttgcagcaaacgga
cagacggttgcacgttatggaaaactatggctcggattgggggcgcacgtggtggtaagg
gatgaaacaatagggaagaatcatgaataa

DBGET integrated database retrieval system