KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0456Help
Entry
NMB0456           CDS       T00027                                 

Gene name
amiC
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  
N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NMB0456 (amiC)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     NMB0456 (amiC)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   NMB0456 (amiC)
Chromosome [BR:nme03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    NMB0456 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(468331..469581)
Genome map
AA seq 416 aa AA seqDB search
MIKLTRRQIIRRTAGTLFALSPIASAVAKTVRAPQFTAARIWPSHTYTRLTLESTAALKY
QHFTLDNPGRLVVDIQNANINTVLHGLSQKVMADDPFIRSIRAGQNTPTTVRLVIDLKQP
THAQVFALPPVGGFKNRLVVDLYPHGMDADDPMMALLNGSLNKTLRGSPEADLAQNTTPQ
PGRGRNGRRPVIMLDPGHGGEDPGAISPGGLQEKHVVLSIARETKNQLEALGYNVFMTRN
EDVFIPLGVRVAKGRARRADVFVSIHADAFTSPSARGTGVYMLNTKGATSSAAKFLEQTQ
NNADAVGGVPTSGNRNVDTALLDMTQTATLRDSRKLGKLVLEELGRLNHLHKGRVDEANF
AVLRAPDMPSILVETAFLSNPAEEKLLGSESFRRQCAQSIASGVQRYINTSVLKRG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactgacacgaagacaaatcatccgccgcaccgccggcacactgttcgcccta
agccccatcgcatccgccgttgccaaaacggtacgcgccccgcaattcaccgccgcacgg
atatggccgtcgcacacctacacccgcctgacgctggaaagcaccgccgcgctcaaatac
cagcacttcacgctcgacaacccgggcaggctggtcgtcgacatacaaaacgcgaacatc
aataccgtattgcacggactgtctcagaaagtcatggcagacgacccctttatccgcagc
atacgcgcgggtcagaacacgccgaccaccgtccgcctcgtcatcgatttgaaacagccc
acccacgcacaagtcttcgcgcttccgcccgtcggcggctttaagaaccgcctcgtcgtc
gacctctatccgcacgggatggatgccgacgatccgatgatggcactgctcaacggtagc
ctgaataaaaccctgcgcggctctcccgaagccgacctcgcccaaaacaccacgccccaa
cccgggcgcggcagaaacgggcgcagacccgtcatcatgctcgatccgggacacggcggt
gaagaccccggcgccatcagcccgggcggtctacaggaaaaacatgtcgtcctatccatt
gccagggaaaccaaaaatcagttggaagcattaggttacaatgtatttatgacgcgcaac
gaagacgtgttcatcccattgggcgtgcgtgtcgccaaagggcgagcacggcgggcggac
gtatttgtctccatccacgccgatgccttcaccagcccctccgcgcgcggcacgggggtt
tatatgttaaacaccaaaggcgcaaccagctctgccgccaaattcttggaacagacgcaa
aacaatgccgacgcggtcggcggcgtaccgaccagcggcaaccgcaatgtcgataccgcc
ctgctcgacatgacccaaaccgccacgctgcgcgacagccgcaaactcggcaaactggtg
cttgaagaattgggcaggctcaaccatctgcacaaaggcagggtggacgaagccaatttc
gccgttttgcgcgcacccgatatgccgtctatcctggtcgaaaccgccttcctgtccaat
cctgccgaagagaagctgctgggcagcgaatccttccgccggcagtgcgcccaatccatt
gcctcgggtgtccaacgctacatcaatacatccgtattgaagcggggttga

DBGET integrated database retrieval system