KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0460Help
Entry
NMB0460           CDS       T00027                                 

Gene name
tbp2
Definition
(RefSeq) transferrin-binding protein B
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
475581..477719
Genome map
AA seq 712 aa AA seqDB search
MNNPLVNQAAMVLPVFLLSACLGGGGSFDLDSVDTEAPRPAPKYQDVFSEKPQAQKDQGG
YGFAMRLKRRNWYPQAKEDEVKLDESDWEATGLPDEPKELPKRQKSVIEKVETDSDNNIY
SSPYLKPSNHQNGNTGNGINQPKNQAKDYENFKYVYSGWFYKHAKREFNLKVEPKSAKNG
DDGYIFYHGKEPSRQLPASGKITYKGVWHFATDTKKGQKFREIIQPSKSQGDRYSGFSGD
DGEEYSNKNKSTLTDGQEGYGFTSNLEVDFHNKKLTGKLIRNNANTDNNQATTTQYYSLE
AQVTGNRFNGKATATDKPQQNSETKEHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVA
VVGSAKTKDKPANGNTAAASGGTDAAASNGAAGTSSENGKLTTVLDAVELKLGDKEVQKL
DNFSNAAQLVVDGIMIPLLPEASESGNNQANQGTNGGTAFTRKFDHTPESDKKDAQAGTQ
TNGAQTASNTAGDTNGKTKTYEVEVCCSNLNYLKYGMLTRKNSKSAMQAGESSSQADAKT
EQVEQSMFLQGERTDEKEIPSEQNIVYRGSWYGYIANDKSTSWSGNASNATSGNRAEFTV
NFADKKITGTLTADNRQEATFTIDGNIKDNGFEGTAKTAESGFDLDQSNTTRTPKAYITD
AKVQGGFYGPKAEELGGWFAYPGDKQTKNATNASGNSSATVVFGAKRQQPVR
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatccattggtgaatcaggctgctatggtgctgcctgtgtttttgttgagtgct
tgtttgggcggaggcggcagtttcgatcttgattctgtcgataccgaagccccgcgtccc
gcgccaaaatatcaagatgttttttccgaaaaaccgcaagcccaaaaagaccaaggcgga
tacggttttgcaatgaggttgaaacggaggaattggtatccgcaggcaaaagaagacgag
gttaaactggacgagagtgattgggaggcgacaggattgccggacgaacctaaggaactc
cctaaacggcaaaaatcggttatcgaaaaagtagaaacagacagcgacaacaatatttat
tcttccccctatctcaaaccatcaaaccatcaaaacggcaacactggcaacggtataaac
caacctaaaaatcaggcaaaagattacgaaaattttaaatatgtttattccggctggttt
tacaaacacgccaaacgagagtttaacttaaaggtggaacctaaaagtgcaaaaaacggc
gacgacggttatatcttctatcacggtaaagaaccttcccgacaacttcccgcttctgga
aaaattacctataaaggtgtgtggcattttgcgaccgatacaaaaaagggtcaaaaattt
cgtgaaattatccaaccttcaaaaagtcaaggcgacaggtatagcggattttcgggcgat
gacggcgaagaatattccaacaaaaacaaatccacgctgacagatggtcaagagggttat
ggttttacctcaaatttagaagtggatttccataataaaaaattgacgggcaaactgata
cgcaacaatgcgaataccgataacaaccaagccaccaccacgcaatactacagccttgag
gctcaagtaacaggcaaccgcttcaacggcaaggcaacggcaaccgacaaaccccaacaa
aacagcgaaaccaaggaacatccctttgtttccgattcgtcttctttgagcggcggcttt
ttcggcccgcagggtgaggaattgggtttccgctttttgagcgacgatcaaaaagttgcc
gttgtcggcagcgcgaaaaccaaagacaaacccgcaaatggcaatactgcggcggcttca
ggcggcacagatgcggcagcatcaaacggtgcggcaggcacgtcgtctgaaaacggtaag
ctgaccacggttttggatgcggtcgagctgaaattgggcgataaggaagtccaaaagctc
gacaacttcagcaacgccgcccaactggttgtcgacggcattatgattccgctcttgccc
gaggcttccgaaagtgggaacaatcaagccaatcaaggtacaaatggcggaacagccttt
acccgcaaatttgaccacacgccggaaagtgataaaaaagacgcccaagcaggtacgcag
acgaatggggcgcaaaccgcttcaaatacggcaggtgataccaatggcaaaacaaaaacc
tatgaagtcgaagtctgctgttccaacctcaattatctgaaatacggaatgttgacgcgc
aaaaacagcaagtccgcgatgcaggcaggagaaagcagtagtcaagctgatgctaaaacg
gaacaagttgaacaaagtatgttcctccaaggcgagcgcaccgatgaaaaagagattcca
agcgagcaaaacatcgtttatcgggggtcttggtacggatatattgccaacgacaaaagc
acaagctggagcggcaatgcttccaatgcaacgagtggcaacagggcggaatttactgtg
aattttgccgataaaaaaattactggtacgttaaccgctgacaacaggcaggaggcaacc
tttaccattgatggtaatattaaggacaacggctttgaaggtacggcgaaaactgctgag
tcaggttttgatctcgatcaaagcaataccacccgcacgcctaaggcatatatcacagat
gccaaggtgcagggcggtttttacgggcccaaagccgaagagttgggcggatggtttgcc
tatccgggcgataaacaaacgaaaaatgcaacaaatgcatccggcaatagcagtgcaact
gtcgtattcggtgcgaaacgccaacagcctgtgcgataa

DBGET integrated database retrieval system