KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0464Help
Entry
NMB0464           CDS       T00027                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB0464
   00565 Ether lipid metabolism
    NMB0464
   00590 Arachidonic acid metabolism
    NMB0464
   00591 Linoleic acid metabolism
    NMB0464
   00592 alpha-Linolenic acid metabolism
    NMB0464
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NMB0464
    3.1.1.32  phospholipase A1
     NMB0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483693..484841
Genome map
AA seq 382 aa AA seqDB search
MPTMGAEMNTRNMRYILLTGLLPMASAFGETALQCAALTDNVTRLACYDRIFAAQLPSSA
GQEGQESKAVLNLTETVRSSLDKGEAVIVVEKGGDALPADSAGETADIYTPLSLMYDLDK
NDLRGLLGVREHNPMYLMPLWYNNSPNYAPGSPTRGTTVQEKFGQQKRAETKLQVSFKSK
IAEDLFKTRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLR
MLGAGFVHQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIAD
YMGYGDVKLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVVRGFHGYGESL
IDYNHKQNGIGIGLMFNDLDGI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaatgggggcggagatgaatacacggaatatgcgctatattcttttgacagga
ctgttgccgatggcatccgcttttggagagaccgcgctgcaatgcgccgctttgacggac
aatgttacgcgtttggcgtgttacgacaggatttttgcggcacagcttccgtcttcggca
gggcaggaagggcaggagtcgaaagccgtactcaatctgacggaaaccgtccgcagcagc
ctggataagggcgaggcggtcattgttgttgaaaaaggcggggatgcgcttcctgccgac
agtgcgggcgaaaccgccgacatctatacgcctttgagcctgatgtacgacttggacaaa
aacgatttgcgcgggctgttgggcgtacgcgaacacaatccgatgtaccttatgccgctc
tggtacaacaattcgcccaactatgccccgggttcgccgacgcgcggtacgactgtacag
gaaaaattcggacagcagaaacgtgcggaaaccaaattgcaggtttcgttcaaaagcaaa
attgccgaagatttgtttaaaacccgcgcggatctgtggttcggctacacccaaagatcc
gattggcagatttacaaccaaggcaggaaatccgcgccgttccgcaatacggattacaaa
cctgaaattttcctgacccagcctgtgaaggcggatttgccgttcggcggcaggctgcgt
atgctcggtgcgggttttgtccaccagtccaacggacagagccgtcccgaatcgcgttcg
tggaacaggatttacgccatggcaggcatggaatggggcaaattgacggtgattccgcgc
gtgtgggtgcgtgcgttcgatcagagcggcgataaaaacgacaatcccgatattgccgac
tatatggggtatggcgacgtgaagctgcagtaccgcctgaacgacaggcagaatgtgtat
tccgtattgcgctacaaccccaaaacgggctacggcgcgattgaagccgcctacacgttt
ccgattaagggcaaactcaaaggcgtggtacgcggattccacggttacggcgagagcctg
atcgactacaaccacaagcagaacggtatcggtatcgggttgatgttcaacgacttggac
ggcatctga

DBGET integrated database retrieval system