KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0466Help
Entry
NMB0466           CDS       T00027                                 

Gene name
aspS
Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMB0466 (aspS)
Enzymes [BR:nme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     NMB0466 (aspS)
Amino acid related enzymes [BR:nme01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   NMB0466 (aspS)
Transfer RNA biogenesis [BR:nme03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMB0466 (aspS)
 Prokaryotic Type
   Other AARSs
    NMB0466 (aspS)
Mitochondrial biogenesis [BR:nme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMB0466 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
485743..487551
Genome map
AA seq 602 aa AA seqDB search
MRTNYCGLISEQYLDQTVTVKGWVHRRRDHGGVIFIDLRDREGIVQVVIDPDTPEAFAAA
DSSRNEYVLSITGRVRNRPEGTTNDKMISGKIEILAKEIEVLNAAATPPFQIDDENISEN
VRLTNRVIDLRRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRSTPEGARDYLVP
SRVHPGEFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLETSFL
NEDEIMDITEGMAKQVFKDALNVDLGDFPRMPYSEAMFYYGSDKPDMRINLKFTELTDLM
KTEEFKVFRGAADMKGGRVVALRVPNGAEFSRKEIDEYTKFVGIYGAKGLAYIKVNDVSN
LSNGEDSGLQSPIVKYLSENALKEIIARTGAQNGDIIFFGADKAKVVNEAIGALRIKVGL
EHGKDNGYFTDEWKPLWVVDFPMFEYDEEADRYVAVHHPFTAPKEGHEDLMVSDPANCLA
RAYDMVLNGWEIGGGSIRIHRADVQEKVFAALKISPEEQQEKFGFLLDNLKFGAPPHGGL
AFGLDRLVTLMTGAESIRDVIAFPKTQRAQCLLTNAPNSVDDKQLRELSLRLRQKATETK
EV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccaactattgcggcctgatcagtgagcaatacttagaccaaaccgttaccgtc
aaaggctgggtacaccgtcgacgcgaccacggcggtgtgatttttatcgacctgcgcgac
cgcgaaggcatcgtccaagtcgtgatcgatcccgacacgcccgaagcgtttgccgctgcc
gattcctcccgcaacgaatacgttttgagcattaccggccgcgtacgcaaccgtcccgaa
ggcacgaccaacgataaaatgatttccggcaaaatcgaaatccttgccaaagaaatcgaa
gtcttgaacgccgccgccacgccgccgttccaaatcgacgatgaaaacatcagcgaaaac
gttcgcctgaccaaccgcgttatcgacttgcgccgtccggtgatgcaacgcaacctgcgc
ctgcgttaccaagttgctatgggcgttcgccgctacttggacgcgcaaggtttcatcgac
attgaaaccccgatgctgacccgctccacgcctgaaggcgcgcgcgactacctcgtgccg
agccgcgttcatccgggcgagtttttcgcgctaccgcaatcgccgcaattattcaaacaa
ctgttgatggtggcgggtttcgaccgttactaccaaatcaccaagtgcttccgcgacgaa
gacctgcgtgccgaccgccagcccgaatttacccaaatcgacttggaaacctcgttctta
aacgaggatgaaatcatggacatcactgaaggcatggccaaacaagtcttcaaagatgct
ttaaatgtagatttgggcgacttcccacgcatgccttactctgaagccatgttctactac
ggctctgacaaaccggatatgcgcatcaacttgaaatttaccgagttgaccgacctgatg
aaaacggaagaattcaaagtcttccgtggcgcagccgacatgaaaggcggccgcgtggtc
gctctgcgcgtgccgaacggcgcagaattcagccgcaaagaaatcgacgaatacaccaaa
tttgtcggcatctacggcgcgaaaggtctggcatacatcaaagtaaacgatgtcagcaac
ctttccaacggcgaagacagcggcctgcaatctccaatcgtgaaatacctgtccgaaaac
gccctgaaagaaattatcgcgcgtaccggcgcgcaaaacggcgacatcatcttcttcggc
gcagacaaagccaaagtcgtgaacgaagccatcggcgcactgcgtatcaaagtcggcttg
gagcacggcaaagacaacggctatttcacagacgaatggaaacctttgtgggtcgttgat
ttcccaatgttcgaatacgacgaagaagccgaccgctacgttgccgtacaccatccgttt
accgcgccaaaagaaggtcatgaagacctgatggtttccgacccggcaaattgtttggca
cgcgcctacgatatggtattgaacggctgggaaatcggcggcggctctatccgtattcac
cgcgcagacgtacaagagaaagtgtttgccgcgctgaaaatcagccctgaagagcaacaa
gagaaattcggcttcctcttggacaacctgaaattcggcgcacctcctcacggcggtctt
gcattcggcctcgaccgtctggtaacgctgatgaccggtgccgaatccatccgcgacgtg
attgccttcccgaaaacacaacgcgcccaatgcctgctgaccaacgcgcccaacagcgtg
gacgacaagcagttgcgtgaattaagtttgcgtttgcgccagaaggcaaccgaaactaaa
gaagtataa

DBGET integrated database retrieval system