KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0468Help
Entry
NMB0468           CDS       T00027                                 

Gene name
speA
Definition
(RefSeq) arginine decarboxylase
  KO
K01585  
arginine decarboxylase [EC:4.1.1.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB0468 (speA)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     NMB0468 (speA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
488153..490045
Genome map
AA seq 630 aa AA seqDB search
MPILTIREVCNINHWGIGYYDVDDSGEIIVRPNPSQHNQTVSLQKLTEAVQQKHQARLPV
LFCFPQILEHRLRDINRAFQTAREECGYKGGYCLVYPIKVNQHRRVIESLMSSGQPHGLE
AGSKAELMAVLAHAGNRQTLIVCNGYKDREYIRFALMGEKLGHQVYLVIEKLSEIQMVLE
EAEKLGIKPRLGVRARLASQGSGKWQSSGGEKSKFGLSASQVLQLVDILKQKNRLDCLQL
LHFHLGSQLGNIRDVATGVHESARFYVELHKLGVNIRCFDVGGGLGVDYEGNRTQSDCSV
NYSLNEYAATVVWGISQACLEHGLPHPTIITESGRGITAHHAVLVANVIGVERYKPRRLD
APSPEAPRVLHSMWETWTDISASREKRSLRSWIHEGQFDLADVHNQYNVGLLSLAQRAWA
EQLYLNICHEVGELFNEKHRSHRTIIDELQERFADKLYVNFSLFQSLPDAWGIDQLFPVC
PITGLNEPIARRAVLLDITCDSDGTIDHYIDGDGIAGTMPMPDYPEEEPPLLGFFMVGAY
QEILGNMHNLFGDTATADVVVGEDGQFTVIDYDEGNTVADMLEYVYQDPKELMKRYREQI
EHSDLPASQAMSFLKELEAGLNGYTYLEDE
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccttaccatccgtgaagtgtgcaacattaatcattggggcataggttattat
gatgttgacgattccggcgaaatcatcgtccgccccaatccctcgcaacacaatcaaact
gtttcactgcaaaaactgactgaagccgtgcaacaaaaacatcaggcgcgcctgcctgtt
ttgttttgttttccgcaaatcctcgaacaccgcctccgcgacattaaccgcgcctttcag
acggcacgggaagagtgcggctataagggcggttattgtttggtttaccctatcaaggtc
aaccaacaccgccgcgtcatcgaatcgcttatgtcaagcggacaaccgcatggtttggaa
gctggttctaaagccgaactgatggcggttttggcacacgccggcaaccggcaaacatta
atcgtctgcaacggctataaagaccgtgaatatatccgtttcgccttgatgggcgaaaaa
ctggggcatcaggtttatttggtgattgagaagctgtccgaaatacaaatggtattggaa
gaggcggaaaaactcggcatcaagccccgtttgggtgtgcgcgccagactggcttcccaa
ggttcgggaaaatggcagtcttcgggtggggaaaaatcaaaattcggcttgtcggcttcc
caagttttgcaactggtcgatattttgaaacaaaaaaacaggctggattgcctgcagctt
ttgcatttccatttgggctcgcagcttgggaacatccgtgatgttgccacaggtgtacac
gaatcggctcggttttatgttgagttgcacaaactgggggtaaatatccgctgttttgat
gtaggcggcgggcttggcgtggattacgaaggaaaccgcacacaatcggattgttccgtt
aattacagcctcaacgaatatgccgccacagtcgtatggggcatcagtcaggcttgtctc
gaacacgggctgccgcatccgacaatcatcaccgagagcgggcgcggcattaccgcacat
cacgccgttttggttgctaatgttataggcgttgaacgttacaaaccgcgccggctggat
gcgccatcgcccgaagcaccgcgtgtgttgcacagtatgtgggaaacttggacggatatt
tccgcctcgcgggaaaaacgttccttacgcagctggatacacgaagggcagtttgatctt
gctgatgtgcataatcagtataatgtcgggctgttgagtttggcgcaacgtgcgtgggcg
gagcaactgtatttaaatatctgtcatgaagtcggcgaattgtttaatgaaaaacaccgg
tctcaccgaaccattattgacgaattgcaagaacgttttgccgataagctgtatgtcaat
ttctcactcttccaatctttgcccgatgcttggggcatagatcaacttttccctgtttgt
cccattaccggtttgaatgaaccgattgcgcgccgcgccgtgttgttggacattacctgc
gattcagacggtacgattgaccactacatcgacggagacggcatcgccggtacgatgcct
atgcctgattatcccgaagaagagccgccgcttttaggcttttttatggtgggagcatat
caggaaatactcggcaatatgcacaatcttttcggcgacactgccactgccgatgttgtt
gtaggggaagacggacaatttaccgtcatcgattacgatgaaggaaacaccgttgccgat
atgctcgaatacgtttatcaagatccgaaagagctgatgaaacgctatcgcgaacaaatc
gaacattcagaccttcctgcctcgcaggctatgtctttcttaaaagaactcgaagcgggg
cttaatggttatacctatttggaagacgaatag

DBGET integrated database retrieval system