KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0474Help
Entry
NMB0474           CDS       T00027                                 

Definition
(RefSeq) biotin synthesis protein BioC
  KO
K02169  malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00780  Biotin metabolism
nme01100  Metabolic pathways
Module
nme_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0474
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.197  malonyl-[acyl-carrier protein] O-methyltransferase
     NMB0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12 PCMT MTS MetW Ubie_methyltran TRM13 Methyltransf_PK
Motif
Other DBs
NCBI-GeneID: 902590
NCBI-ProteinID: NP_273521
UniProt: Q9K0T8
Position
496024..496806
Genome map
AA seq 260 aa AA seqDB search
MESLTAINKSRIRQAFQKALNDYDRHALIQQKMTINLMTHLQDYLPDMPLENVLELGCGS
GMLSALLQKQISANYWLFNDLCNVQPQLAEKLPQSFDFYCGDAENFPFQRQFDLIASASA
VQWFHQPDAFITHCKTGLKTNGLLAVATFGKDNLKEVRQITNIGLNYPTLSQWQAWLAKD
FELLWCEDFTVILDFDTPSDVLKHLKYTGVTATNQKNWTRKNLNGFIGDYLSAFGMPSGK
VRLTYHPLFFIARYSAAGRQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactgactgccataaataaatcgcgcattcggcaggctttccaaaaagcatta
aacgattatgaccggcacgccttaatccaacaaaaaatgacgattaatttaatgacgcat
ttgcaagattatttgccggatatgccattggaaaacgtgttggaattgggctgcggctca
ggaatgttgagtgccttgctgcaaaaacagatttcagcgaattattggttatttaatgat
ttgtgcaatgtgcagccccaactggctgaaaaactgccgcaatcctttgatttttattgc
ggcgatgcggaaaactttccttttcaacgacaatttgacttaatcgcaagcgcatctgcc
gtgcaatggtttcatcaacccgacgcttttatcacccattgcaaaacaggcttgaaaaca
aacggattattggcggttgcaacctttggcaaagacaatttaaaagaagtccgccaaatt
acaaatataggcttaaattacccgactttatcccaatggcaggcttggttagccaaagat
tttgagcttttatggtgtgaggattttacggtaatactagactttgatacgccgtcagat
gtactcaaacaccttaaatatacaggcgtaacagccacgaaccaaaaaaattggacaaga
aaaaatctcaatggatttattggcgattacttgtcggcgttcggtatgccgtcgggcaaa
gtgcgcctgacttatcatccgttattttttatcgcgcgctactctgcggcgggcaggcaa
taa

DBGET integrated database retrieval system