KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0474Help
Entry
NMB0474           CDS       T00027                                 

Definition
(RefSeq) biotin synthesis protein BioC
  KO
K02169  
malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Biotin metabolism
Metabolic pathways
Module
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0474
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.197  malonyl-[acyl-carrier protein] O-methyltransferase
     NMB0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
496024..496806
Genome map
AA seq 260 aa AA seqDB search
MESLTAINKSRIRQAFQKALNDYDRHALIQQKMTINLMTHLQDYLPDMPLENVLELGCGS
GMLSALLQKQISANYWLFNDLCNVQPQLAEKLPQSFDFYCGDAENFPFQRQFDLIASASA
VQWFHQPDAFITHCKTGLKTNGLLAVATFGKDNLKEVRQITNIGLNYPTLSQWQAWLAKD
FELLWCEDFTVILDFDTPSDVLKHLKYTGVTATNQKNWTRKNLNGFIGDYLSAFGMPSGK
VRLTYHPLFFIARYSAAGRQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactgactgccataaataaatcgcgcattcggcaggctttccaaaaagcatta
aacgattatgaccggcacgccttaatccaacaaaaaatgacgattaatttaatgacgcat
ttgcaagattatttgccggatatgccattggaaaacgtgttggaattgggctgcggctca
ggaatgttgagtgccttgctgcaaaaacagatttcagcgaattattggttatttaatgat
ttgtgcaatgtgcagccccaactggctgaaaaactgccgcaatcctttgatttttattgc
ggcgatgcggaaaactttccttttcaacgacaatttgacttaatcgcaagcgcatctgcc
gtgcaatggtttcatcaacccgacgcttttatcacccattgcaaaacaggcttgaaaaca
aacggattattggcggttgcaacctttggcaaagacaatttaaaagaagtccgccaaatt
acaaatataggcttaaattacccgactttatcccaatggcaggcttggttagccaaagat
tttgagcttttatggtgtgaggattttacggtaatactagactttgatacgccgtcagat
gtactcaaacaccttaaatatacaggcgtaacagccacgaaccaaaaaaattggacaaga
aaaaatctcaatggatttattggcgattacttgtcggcgttcggtatgccgtcgggcaaa
gtgcgcctgacttatcatccgttattttttatcgcgcgctactctgcggcgggcaggcaa
taa

DBGET integrated database retrieval system