KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0536Help
Entry
NMB0536           CDS       T00027                                 

Definition
(RefSeq) Na+/H+ antiporter
  KO
K03315  
Na+:H+ antiporter, NhaC family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
557514..558893
Genome map
AA seq 459 aa AA seqDB search
MFAFKSLLDMPRGEALAVVVALIAAMGYTIISLEWLPHMSIIAAIVVLILYGLARGLKYN
DMQQGMIGALNQGMGAIYLFFFIGLMVSALMMSGAIPTLMYYGFGLISPTYFYFSSFALC
SVIGVSIGSSLTTCATVGVAFMGMAAAFQADMAMTAGAIVSGAFFGDKMSPLSDTTGISA
SIVGIDLFEHIKNMMYTTIPAWLISAALMLWLLPNVAAQDLNSVESFRSQLEATGLVHGY
SLIPFALLVILALMRINAVVAMLFTVMVAVAVTYLHSTPDLRQLGAWFYGGYKLEGEAFK
DVVKLISRGGLESMFFTQTIVILGMSLGGLLFALGVIPSLLEAIRTFLTNAGRATFSVAM
TSVGVNFLIGEQYLSILLSGETFKPVYDKLGLHSRNLSRTLEDAGTVINPLVPWSVCGVF
ISHALGVPVWEYLPYAFFCYLSLALTLLFGWTGLTLSKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctttcaaatccttactcgatatgccgcgcggtgaggcacttgccgtcgtcgtc
gctctgattgccgcgatgggctataccatcatttcattggagtggttgccgcatatgtcc
attattgccgccatcgtcgtgctgattttgtacggcttggcgcgcggtttgaaatacaac
gatatgcagcagggcatgataggcgcgttgaatcagggtatgggcgcgatttacctgttt
ttcttcatcgggctgatggtcagcgcgctgatgatgagcggcgcgattccgacgctgatg
tattacggtttcggactgatttccccgacttatttttatttttcctccttcgcgctgtgt
tccgtcatcggcgtgtccatcggcagcagcctgaccacctgcgccactgtcggcgttgcc
tttatggggatggcggcggcgtttcaggccgatatggcgatgacggcgggcgcgattgtt
tcgggcgcattttttggcgacaaaatgtccccgctttcggatacgacgggtatttccgcg
tccatcgtcggcatcgacttgtttgagcacatcaaaaatatgatgtacaccaccatcccc
gcgtggctcattagtgcggcactgatgctttggcttttgccgaatgtcgccgcgcaggat
ttgaacagcgtcgaatccttccgcagccagcttgaagccacgggattggtgcacggctat
tcgctgattccgtttgcgctgttggtcattttggcattgatgcgcatcaacgccgtcgtc
gccatgctctttaccgtcatggttgccgttgctgtaacgtatctgcacagcacgcccgat
ctgcgtcagctcggtgcgtggttttacggcggctacaaactcgaaggcgaagcgtttaaa
gatgttgtcaaactgatttcgcgcggcggtttggaaagtatgtttttcacgcaaaccatc
gtgattctcgggatgagtttgggcggactgttgtttgcgctcggtgtgattccttccctg
ttggaggccatccgtaccttcttgacgaatgccggacgcgcgacgttcagcgttgccatg
acttcggtcggggttaatttcctgatcggcgagcaatatttgagtattttgttgtcgggt
gaaacgttcaaacccgtttacgataagctcggtctgcattcgcgcaatctgtcgcggacg
ctggaagatgcggggacggtgattaacccgctcgtaccgtggagcgtatgcggcgtgttc
atcagccacgcgctgggcgtgccggtttgggaatatctgccgtatgcctttttctgctat
ttgagtttggctttgaccctgttattcggttggacggggctgactttgagcaaaaaataa

DBGET integrated database retrieval system