KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0540Help
Entry
NMB0540           CDS       T00027                                 

Gene name
aspC
Definition
(RefSeq) aromatic amino acid aminotransferase
  KO
K00813  
aspartate aminotransferase [EC:2.6.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB0540 (aspC)
   01230 Biosynthesis of amino acids
    NMB0540 (aspC)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0540 (aspC)
   00270 Cysteine and methionine metabolism
    NMB0540 (aspC)
   00220 Arginine biosynthesis
    NMB0540 (aspC)
   00330 Arginine and proline metabolism
    NMB0540 (aspC)
   00350 Tyrosine metabolism
    NMB0540 (aspC)
   00360 Phenylalanine metabolism
    NMB0540 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0540 (aspC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB0540 (aspC)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     NMB0540 (aspC)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class I
   NMB0540 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(561821..563014)
Genome map
AA seq 397 aa AA seqDB search
MFFKHIEAAPADPILGLGEAFKAETRPEKVNLGIGVYKDASGATPLVKAVKEAEKRLLES
ETTKNYLTIDGVADYNAQTQILLFGKDHEIIASRRAKTAQSLGGTGALRIAAEFAKRQLN
AQTIWISNPTWPNHNAIAKAVGIQDKPYRYYDAAKHGLDWDGMIEDLSQAQKGDIVLLHG
CCHNPTGIDPTPEQWETLAKLSAEKGWLPLFDFAYQGFGNGLEEDAYGLRVFLKHNTELL
IASSYSKNFGMYNERVGAFTLVAEDEETAARAHSQVKTIIRTLYSNPASHGANTIALVLK
NDDLKAQWIAELDEMRGRIKAMRQKFVGLLKAKGASQNFDFIIKQNGMFSFSGLTPEQVD
RLKNEFAIYAVRSGRINVAGITDNNIDYLCESIVKVL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagcacatcgaagccgcccccgccgatccgattctcggtttgggcgaagcg
ttcaaagccgaaacccgccccgaaaaagtcaacctcggcatcggcgtttataaagacgca
tccggcgcgacacccctcgtcaaagccgtcaaagaagccgaaaaacgcctgttggaaagc
gaaaccaccaaaaactacctcaccatcgacggcgttgccgactacaacgcgcaaacccaa
atcctgctgttcggcaaagaccacgaaatcatcgccagccgtcgcgccaaaacagcgcaa
agcctcggcggtacgggcgcattgcgtattgcggccgagtttgccaaacgccagttgaac
gcgcaaaccatctggatttccaatccgacttggcccaaccacaacgccatcgccaaagcg
gtcggtatccaagacaaaccttatcgttactatgatgccgccaaacacggtttggattgg
gacggcatgattgaggacttgagccaagcgcaaaaaggcgacatcgtcctgctgcacggc
tgctgccacaatcctaccggcatcgaccctacgcccgaacaatgggaaactttggcaaaa
ctttctgccgaaaaaggctggttgccgctgtttgactttgcctaccaaggcttcggcaat
ggtttggaagaagatgcctacggcttgcgcgtgttcttgaaacacaatacagaattgctg
attgccagctcttattccaaaaacttcggtatgtacaacgagcgcgtcggcgcgttcact
ttggtggccgaagatgaagaaacagcagcccgcgcccacagccaagtcaaaaccatcatc
cgtaccttgtattccaacccggcttcacacggtgcgaacaccattgcgctggtgttgaaa
aatgatgatttgaaagcacaatggattgccgaactcgatgaaatgcgcggccgcatcaaa
gccatgcgccaaaaatttgtcgggttgctcaaagccaaaggtgcaagccaaaactttgat
ttcattatcaaacaaaacggtatgttctctttcagcggcttgactcccgaacaagtcgac
cgcctgaaaaacgagtttgccatttatgccgtccgctccggccgcatcaacgtcgccggc
attaccgacaacaacatcgattatctgtgcgaaagcatcgtgaaagtactgtaa

DBGET integrated database retrieval system