KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0544Help
Entry
NMB0544           CDS       T00027                                 

Definition
(RefSeq) UDP-2,3-diacylglucosamine hydrolase
  KO
K03269  
UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0544
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.54  UDP-2,3-diacylglucosamine diphosphatase
     NMB0544
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(565936..566658)
Genome map
AA seq 240 aa AA seqDB search
MKPAYFISDLHLSEKQPELTALLLRFLRSSAAGQARAIYILGDLFDFWVGDDEVSELNTS
VAREIRKLSDKGVAVFFVRGNRDFLIGQDFCRQAGMTLLPDYSVLDLFGCKTLICHGDTL
CTDDRAYQRFRKIVHRKRLQKLFLMLPLKWRTRLATKIRRVSKMEKQVKPADIMDVNAAF
TARQVRAFGAERLIHGHTHREHIHHENGFTRIVLGDWHNDYASILRVDGDGAVFVPLEKY
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgcctatttcatttccgacctgcatttgagcgaaaagcagcccgaactgacc
gcgctgctgctgcgttttttacgttcttccgccgccgggcaggcgcgggcgatttacatt
ttgggcgatttgtttgatttttgggtgggcgatgacgaagtttccgagttgaatacttcg
gttgcgcgtgaaatcaggaaattgtccgacaaaggcgttgccgtgttcttcgtcaggggc
aaccgcgacttcctgatcggtcaggatttttgccggcaggcgggcatgacgctgctgccg
gattactcggttttggacttgttcggctgcaaaaccctcatctgccacggcgacactctg
tgtacagatgacagggcataccaacgtttccgcaaaatcgtgcatcggaagcggctgcaa
aaactgttcctaatgctgcccctgaagtggcgcacgcgccttgccaccaaaatcaggcgt
gtcagcaaaatggaaaaacaggtcaagcccgccgatattatggatgtcaatgccgccttt
accgcgcggcaggtacgcgccttcggtgcggaaaggctgatacacggacacacccaccgc
gagcatatccatcacgaaaacggctttacccgcatcgttttgggcgactggcataacgac
tatgcttcaatcctccgcgtggacggggacggcgcggtattcgtgccgctggaaaaatac
tga

DBGET integrated database retrieval system