KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0559Help
Entry
NMB0559           CDS       T00027                                 

Gene name
ubiB
Definition
(RefSeq) ubiquinone biosynthesis protein UbiB
  KO
K03688  
ubiquinone biosynthesis protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
586971..588482
Genome map
AA seq 503 aa AA seqDB search
MKWLKRLTVIVGTFYRYRLAGLCASLMGSGWICALLKMMPQSSKLKNEPPAVRLRLALES
LGPIFIKFGQVLSTRPDLIPHDYAVELAKLQDKVPPFDARLSREQIEKSLGQSIEKLYAE
FETEPIASASIAQVHKARLHSGEQVAVKVLRPNLLPVIEQDLSLMRFGAGWVERLFADGK
RLKPREVVAEFDKYLHDELDLMREAANASQLGRNFQNSDMLIVPKVFYDYCTSDVLTIEW
MDGTPVSDIAKLKADGIDLHKLADYGVEIFFTQVFRDGFFHADMHPGNILVAADNRYIAL
DFGIVGTLTDYDKRYLAINFLAFFNRDYRRVATAHIESGWVPADTRAEELEAAVRAVCEP
VFNKPISQISFGLVLMRLFEVSRRFNVEIQPQLVLLQKTLLNIEGLGRQLDPDLDLWKTA
KPFLVKWMNGQVGPKALWRNLKNEAPDWAQIIPSLPRKISALIDENRQQEMRDAYIHLVK
VQQRQSLWLAVIAVVLLLILLLK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttgaaacgcctgacggttattgtcgggactttttaccgctatcggctggca
ggtctgtgtgcttcgctgatgggtagcggttggatatgcgctctgctgaaaatgatgccg
cagtcgtccaaattgaaaaacgaaccgcctgctgtccgtctgcgccttgccttggaaagc
ctggggccgattttcatcaagttcgggcaggttttgtccacacgccccgatttgattccg
cacgattacgccgtcgaactggcaaagctgcaagacaaagtgccgccttttgacgcgcgg
ctttcgcgtgaacaaatcgaaaaatcgttgggtcagtccatcgaaaagctgtatgcggaa
tttgaaaccgagcccatcgccagcgcgtccatcgcccaagtacacaaagcccgcctgcat
tcgggcgaacaagtggcggttaaagttttgcgccccaaccttttgcccgtgatcgaacag
gatttgtcgctgatgcgctttggtgcaggctgggtcgagcgtctgtttgccgacggcaag
cgtctgaagccgcgcgaagtggtggcggagttcgacaaatatctgcacgacgagttggac
ttgatgcgcgaagccgccaatgccagccagctcggacgcaatttccaaaacagcgatatg
ctgattgtgccgaaggtgttttacgactactgcaccagcgacgtgctgaccatcgaatgg
atggacggcacgccggtttccgacatcgccaaactcaaagcagacggcatcgatttgcac
aaactcgccgattacggcgtggaaatcttcttcacgcaagtcttccgcgacggctttttc
cacgcggatatgcaccccggcaatattttggttgccgccgacaaccgctacatcgccctc
gatttcggcatcgtcggcacgctgaccgattacgacaaacgttatctcgccatcaacttc
ctcgccttcttcaaccgcgattaccggcgcgtcgccaccgcccacatcgaatcgggctgg
gtgcccgccgacacgcgcgcggaagagttggaagcggctgtccgcgccgtgtgcgaacca
gtgttcaacaaaccgatttcgcagatttccttcggcttggtgctgatgcgcctgtttgaa
gtcagccgccgcttcaatgtcgaaatccagccgcagctggtattgctgcaaaaaacgctg
ctcaacatcgaaggcttgggacggcagcttgatcccgatttggacttgtggaaaaccgcc
aaaccgtttttggtgaaatggatgaacgggcaggtcggccctaaagccctttggcgcaac
ctcaaaaacgaagcccccgactgggcgcaaatcatcccttcattgccgcgcaaaatcagt
gcgttgattgatgaaaaccgccagcaggaaatgcgtgatgcctatatccatttggtcaaa
gtgcagcagcggcaaagcctgtggctggctgtgattgcggttgttttgctgctgattttg
cttttgaaatag

DBGET integrated database retrieval system