KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0560Help
Entry
NMB0560           CDS       T00027                                 

Gene name
cysE
Definition
(RefSeq) serine acetyltransferase
  KO
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0560 (cysE)
   01230 Biosynthesis of amino acids
    NMB0560 (cysE)
  Energy metabolism
   00920 Sulfur metabolism
    NMB0560 (cysE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0560 (cysE)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     NMB0560 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(588839..589657)
Genome map
AA seq 272 aa AA seqDB search
MKKDHLNTTGFDLWHTIREETAAAVSAEPMLASFLHQTVLRHESLGSVLAYHLSSKLGSP
IMDVRALFEIYQQALGSDTQIGKCVEADLKAIYERDPACDEYSLPLLYFKGFHAIQAHRI
NHRLYLDGRKTLAYFLQNRMSEVFGVDIHPAARFGYGLMLDHATGFVAGETAVLGNNISI
LHGVTLGGSGKEGGDRHPKIGDGVMIGANASILGNIRIGSNAKIGAGSVVVSDVPPSITV
VGVPAKPVARSLKTPSADMDQNIQFTEIDFMI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaccatttaaacacaaccggtttcgacctctggcacaccatccgcgaagaa
accgcggccgcggtctccgccgaaccgatgctggcaagttttttgcaccaaaccgtgttg
cgccacgagtccctcggctccgtccttgcctaccacctttccagcaaactcggcagcccg
attatggacgtgcgcgcgctgtttgaaatctaccagcaggcgttgggcagcgacacccaa
atcggcaaatgcgtcgaagcagacttaaaagccatctacgaacgcgatcccgcctgcgac
gaatattcgctgccgcttttatatttcaaaggcttccacgcgattcaggcacaccgcatc
aaccatcggctgtatctcgacgggcgcaaaacgctggcgtatttcctgcaaaaccgtatg
tccgaagtattcggcgtggacatccatcccgccgcccgtttcggatacgggctgatgctc
gaccacgccaccggctttgttgccggcgaaaccgccgtgttgggcaacaatatttcgatt
ttgcacggcgtaacgctcggcggttcgggcaaagaaggcggcgaccgccaccctaaaatc
ggcgacggcgtgatgatcggcgcaaacgcctcgatattgggcaatatccgcatcggcagc
aatgccaaaatcggggcgggcagcgtcgtggtttcagacgtgccgccgtccatcacggtt
gtcggcgtacccgccaaacccgtggcgcgatcgctcaaaacaccgtcggcggatatggat
caaaatatccagtttaccgaaatcgactttatgatttga

DBGET integrated database retrieval system