KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0564Help
Entry
NMB0564           CDS       T00027                                 

Gene name
nqrF
Definition
(RefSeq) Na(+)-translocating NADH-quinone reductase subunit F
  KO
K00351  
Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC:1.6.5.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.8  NADH:ubiquinone reductase (Na+-transporting)
     NMB0564 (nqrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(592145..593362)
Genome map
AA seq 405 aa AA seqDB search
MEIILGIVMFTVIVLVLALMILFAKSKLVSEGDITIKVNGEKELTMPAGGKLLGALANEG
IFIPSACGGGGSCGQCRVVVKSGGGDILPTELSHISKREAREGCRLSCQVNVKTDMDIEV
PEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEVPFRAGGYIQIEAPPHTVAYKDFD
IPKEYHEDWDKYNLWQYVSKVDEPILRAYSMASYPEEKGIIMLNVRIATPPPRVPDAPPG
QMSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLNSKR
KITFWYGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDNWDGYTGFIHNVVYENH
LKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILLDDFGG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagattattttaggtatcgtgatgtttaccgtcatcgttttggttttggcactgatg
attctgtttgccaaatccaaactggtcagcgaaggcgacatcaccatcaaagtcaacggc
gaaaaagagctgacgatgcccgccggcggcaaactcttgggcgcgcttgccaacgaaggc
atctttatcccctccgcctgcggcgggggcggttcgtgcggacaatgccgcgtcgtcgta
aaaagcggcggcggcgacatcctgccgaccgagctgtcccacatcagcaaacgcgaagca
cgcgaaggctgccgtctgtcgtgccaagtcaacgtcaaaaccgacatggacatcgaagtc
cccgaagaagtgttcggcgtgaaaaaatgggaatgcaccgtcatctccaacgataacaaa
gccacgttcattaaagaactcaagcttgccattcccgaaggcgaagaagtccccttccgc
gccggcggctacattcaaattgaagctcctcctcacactgttgcctacaaagacttcgac
attcctaaggaatatcacgaagactgggacaaatacaatttgtggcaatacgtttccaaa
gtggacgagccgattttgcgtgcctactctatggcttcgtatcctgaagaaaaaggcatc
attatgctgaacgtgcgtatcgccacgccgcccccgcgcgtacctgatgcgcctccggga
caaatgtcgtcctacatctggtcgctcaaacccggcgacaaagttacgatttccggcccg
ttcggcgaatttttcgccaaagacaccgatgccgaaatggtatttatcggcggcggtgcg
ggtatggctccgatgcgttcccacattttcgaccagttgaaacgtttgaactccaaacgt
aagattaccttctggtacggcgcacgttccaaacgcgagatgttctatgtcgaagacttt
gaccaactcgcggcagagttcccgaacttcacgtggcacgtcgccctgtccgacccgctg
ccggaagacaactgggacggctacacgggcttcattcacaacgtggtttacgaaaaccac
ctgaaaaaccacgaagcaccggaagactgcgaattttatatgtgcggccctccgattatg
aaccagtccgtcatcaaaatgctcaaagacttgggcgtggaagacgaaaacatcctcttg
gacgatttcggcggttaa

DBGET integrated database retrieval system