KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0576Help
Entry
NMB0576           CDS       T00027                                 

Gene name
hemA
Definition
(RefSeq) glutamyl-tRNA reductase
  KO
K02492  
glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0576 (hemA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     NMB0576 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
603879..605126
Genome map
AA seq 415 aa AA seqDB search
MQLTAVGLNHQTAPLSIREKLAFAAAALPKAVRNLARSNAATEAVILSTCNRTELYCVGD
SEEIIRWLADYHSLPIEEIRPYLYALDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAV
RVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNV
LFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHDY
DVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDM
VNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIKALRDEGEKARKQVLENA
MKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaccgctgtcggactcaatcatcaaaccgcacctttaagcatacgggaaaag
ctggcgtttgccgccgccgccctgcctaaagccgtccgcaatcttgcccgaagcaatgcg
gcaacggaggcggtaatcctttctacctgcaaccgcaccgagctttactgcgtcggtgat
tcggaagaaatcatccgatggcttgccgattaccacagtttgccgattgaagaaatccgt
ccgtatctgtacgcgctggatatgcaggagactgtgcgccatgctttccgcgtcgcctgc
gggctggattcgatggtgttgggcgagccgcagattttaggacagattaaggatgccgtt
agggttgctcaagagcaggaaagtatgggtaagaaactcaatgccctgttccaaaaaacc
ttttccgttgctaaagaggtccgtaccgatactgccgtcggcgaaaactcggtttccatg
gcttccgcttccgtcaaattggcggaacagatttttcccgacatcggcgatttgaatgtc
ttgtttatcggcgcaggcgaaatgattgagctggttgccacttattttgccgccaaaagt
ccccggctgatgacggttgccaaccggacgctggcgcgtgcacaggagttgtgcgacaag
ctcggtgtcaacgccgaaccgtgcctgctgtccgatctgcctgccattctgcacgattac
gacgtagtggtttcttcaacggcaagccagttgcccattgtcggcaaaggcatggtggag
cgtgcattgaaacaaaggcagagtatgccgttgttcatgcttgatttggcagtgccgcgt
gacattgaagcggaagtcggcgatttgaatgatgcctatctttatacggtggacgatatg
gtcaatatcgtccaaagcggcaaggaggcaaggcagaaggccgccgccgccgccgaaacg
ctggtgtccgagaaagttgccgaatttgtcaggcagcagcagggcaggcagagtgtcccc
ttgattaaggcgttgcgggacgagggcgagaaagcgcgcaaacaggtgttggaaaatgcc
atgaaacagcttgccaaaggcgcaacggcagaagaggttttggaacggctgtccgtccaa
ctgaccaacaagctgctgcattcgccgacccaaaccttgaataaggcgggggaagaagat
aaagatttggttcatgccgtcgcgcagatttatcatttggacaaataa

DBGET integrated database retrieval system