KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0578Help
Entry
NMB0578           CDS       T00027                                 

Gene name
nosD
Definition
(RefSeq) copper ABC transporter substrate-binding protein
  KO
K07218  
nitrous oxidase accessory protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
606028..607062
Genome map
AA seq 344 aa AA seqDB search
MSLPAMDAGIYLEETAPRALIEHNNILDNSVGVYLHGSADAMVRENKIVGDATLRVNERG
NGVTVWNAPGAQVVGNDISKGRDGIFSNTSTHNTYKNNRFSDLRFAVHYMYTNDSEISGN
ISVGNNMGYVLMFSERLKVFDNIAVGSRDQGIMLNYVNYSDIHDNIINKAGKCVFAYNAN
YDKLFANHFENCQIGIHFTAAIEGTSLHDNSFINNESQVKYVSTRFLDWSEGGHGNYWSD
NSAFDLNGDGFGDSAYRPNGIIDQIIWRAPVSRLLMNSPAISIVKWAQAQFPAVLPGGVV
DSKPLMKPYAPKIQTRYQAMKDELLKEVETRQSEWGRAENGSLN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccgcaatggatgccggtatttatctcgaagaaactgccccgcgcgccctg
attgaacacaacaatattttggataattcggtcggcgtatatctgcatggttctgccgat
gcgatggtgcgcgagaataaaatcgtcggcgacgcgactttgcgcgtgaacgagcgcggc
aacggcgttaccgtttggaacgcacccggtgcgcaggtcgtcggcaacgacatttccaaa
gggcgggacggcattttttccaataccagcacgcacaacacctacaaaaacaaccgcttc
agcgatttgcgtttcgccgtccactatatgtacaccaacgacagcgaaatcagcggcaat
atttccgtgggcaacaatatgggctatgtgctgatgttttccgagcggctcaaagtattc
gacaatatcgccgtcggcagccgcgatcagggcattatgctcaactatgtcaactattcc
gatattcacgacaacattatcaacaaggcaggcaagtgcgtatttgcctataatgccaac
tacgataaacttttcgccaatcattttgaaaactgtcaaatcggcatacactttaccgcc
gccatcgaaggcacgtccttgcatgacaattcctttatcaacaacgaaagccaggtcaaa
tacgtcagcacgcgctttctcgattggagcgagggcggacacggcaactattggagcgac
aacagcgcgttcgatttgaacggcgacggcttcggagacagcgcgtaccgccccaacggc
atcatcgaccaaatcatctggcgcgcgcccgtatcgcgccttttgatgaacagtcccgca
atcagcatcgtcaaatgggcgcaggcgcagtttcccgccgttctgcctggcggcgtggtg
gacagcaaaccgctgatgaagccttatgcccccaaaattcaaacccgttatcaggcgatg
aaggacgagctactcaaagaagtcgaaacgcggcagtcggaatggggcagggcggaaaac
ggttctttgaactag

DBGET integrated database retrieval system