KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0586Help
Entry
NMB0586           CDS       T00027                                 

Definition
(RefSeq) adhesin
  KO
K02077  
zinc/manganese transport system substrate-binding protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Module
Putative zinc/manganese transport system
Brite
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative zinc/manganese transporter [MD:M00244]
    NMB0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(618299..619213)
Genome map
AA seq 304 aa AA seqDB search
MKHLKLTLIAALLTASATAAPLPVVTSFSILGDVAKQIGGERVSIQSLVGANQDTHAYHM
TSGDIKKIRSAKLVLLNGLGLEAADVQRAVKQSKVSYTEATKGIQPLKAEEEGGHHHDHD
HDHEGHHHDHGEYDPHVWNDPVLMSAYAQNVAKALIKADPEGKVYYQQRLGNYQMQLKKL
HSDAQAAFNAVPAAKRKVLTGHDAFSYMGKRYHIEFIAPQGVSSEAEPSAKQVAAIIRQI
KREGIKAVFTENIKDTRMVDRIAKETGVNVSGKLYSDALGNAPADTYIGMYRHNIKALTN
AMKQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacctcaaactcacccttattgccgcattgctgaccgcctccgcaactgccgcc
cccctgccggttgtaaccagcttcagcattttaggcgacgtagccaaacaaatcggcgga
gagcgcgtatccatacaaagtttggtcggagccaaccaagatacgcacgcctatcatatg
accagtggcgacattaaaaaaatccgcagtgcaaaactcgtcctgctcaacggcttagga
cttgaagctgccgatgtgcaacgcgccgtcaaacaaagcaaagtatcctataccgaagcg
accaaaggcatccaacccctcaaagccgaagaagaaggcggacaccatcacgaccacgat
catgaccacgaaggacaccaccatgaccacggcgaatatgacccgcacgtctggaacgac
cccgtccttatgtccgcctatgcccaaaacgttgccaaagccctgataaaggccgatccc
gaaggcaaagtttattatcaacaacgcttgggcaactaccaaatgcagctcaaaaaactg
cacagcgacgcacaagccgcatttaatgccgtccctgctgccaaacgcaaagtcctgacc
gggcacgatgccttttcctatatgggcaaacgttaccatatcgaattcatcgccccgcaa
ggcgtgagcagcgaagccgagccttcggccaaacaagtcgccgccatcatccgacaaatc
aaacgcgaaggcatcaaagccgtctttaccgaaaacatcaaggacacccgtatggttgac
cgtatcgccaaagaaaccggtgtcaacgtcagcggcaaactgtattccgacgcactcggc
aacgcgcccgcagacacctacatcggaatgtaccgccacaacatcaaagccttgaccaac
gcgatgaagcaataa

DBGET integrated database retrieval system