KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0612Help
Entry
NMB0612           CDS       T00027                                 

Gene name
potC
Definition
(RefSeq) spermidine/putrescine ABC transporter permease
  KO
K11074  
putrescine transport system permease protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Module
Putrescine transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB0612 (potC)
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    NMB0612 (potC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
642519..643406
Genome map
AA seq 295 aa AA seqDB search
MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGFSTKWYGALLENDTIL
EAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMISAPMVMPDVITGLSML
LLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVVIRSRLVELDQSLEEAAM
DLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSFLSGPGSSTLPQVIFSKIK
LGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRDREAAEAYRQEKLAAEKAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatccaaattatcttggttcttgaaactgatgttggcactgtcgctggcgttt
ctgtatatcccgctggttgttttggtcatctattcgtttaacgaatccaagctggtaacc
gtttggggcggcttttcgaccaagtggtacggcgcattgctggaaaacgacaccatcttg
gaagccgcttggctgtcgctgcggattgccgttgtgtcttcgcttgccgccgtcgttttg
ggcacgctggcaggctatgcgatggcgcggattaaacgttttcgcggcagtaccttgttc
gctggcatgatttccgcacctatggtgatgcccgacgtgattaccggtctgtctatgctg
ctgctgattattcaggtacagatatttttgcagggcagcgaatggttacaacatctctac
ttcgatcgtggctttttcaccatcttcctcggacatacgacgctgtgtatggcgtacatt
accgttgttatccgttcgcgtctggttgagcttgaccagtcgctcgaagaagccgcaatg
gatttgggcgcgcgcccgctgaaaatcttttttgtcatcactttgcctttgattgcccct
gccatcgcttcaggctttctgctcggcattaccctgtctttggatgatttggtgattacc
tcattcctctccggccccggttcatccacattgccgcaggtgattttctccaaaatcaag
ttgggtctcgatcctcagatgaatgtcttggcgaccatcctaatcggcatcatcggaaca
ttggtcatcatcgtcaattattggatgatgaggcaggcaaccaagcgtgaccgagaagcg
gcagaagcctaccgccaggaaaaattggctgccgagaaagcaaattaa

DBGET integrated database retrieval system