KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0614Help
Entry
NMB0614           CDS       T00027                                 

Definition
(RefSeq) oxidoreductase
  KO
K09471  
gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB0614
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     NMB0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
643532..644827
Genome map
AA seq 431 aa AA seqDB search
MIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKTDTCIIGGGLGGLCTALPLAEQGHETVV
LEAARIGFGASGRSGGQVISDYACGMGEIEKQVGLEQAQWFWQQSLQAVELVDERVRKHA
VDCDWQRGYATVAVRPQHWEELQQWHEHAQRHYGASHYQLWDKAELKQQLDSDMYQGAQF
DPLSGHLHPLTYTLGIARAAAEAGAQIFEQSPMTCIEPHQNGWLVYTPEGSVECKNVVYA
VNTYAGLNPIFRPLERKAIAVSTFIIATEPLGARAKGLIRNNMAVCDNRHILDYYRLSAD
GRLLFGGKDNEFIDNPERMTELVRQDMLKVFPQLADVKIEYSWGGECDITANLVPHFGRL
APNVFYAQGYSGHGMAITGIAGLAVAEAILGDECRLKPFERLRQPNIILQPFLRKLGSFL
GSKYYQWKDSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcgccctgattttcaagaatatctgccttcttattatttcagttcggttaatcct
catactgtttatccgaaacttcaatgccgtctgaaaaccgatacctgtatcatcggcggc
ggattgggtggtttgtgcactgcattgcccttggcggagcagggacatgaaacggttgtg
ttggaagccgcgcgtatcggtttcggcgcgtcgggacggagtggcgggcaggttatcagc
gattacgcctgcggtatgggggaaattgaaaaacaggtcggcttggagcaggcgcaatgg
ttttggcaacagtctttgcaggcggtcgaactggtggacgaacgcgtccgcaaacatgcc
gtcgattgtgattggcagcgcggttatgccacggttgccgtccgtccgcagcattgggaa
gagttgcagcagtggcatgaacacgcccaacggcattacggtgcgagtcattatcaactt
tgggataaagccgagttgaaacagcagcttgacagcgatatgtaccaaggggcacaattc
gaccccttatccggacacctgcatccgctcacttacactttgggcatcgctcgtgccgct
gccgaagccggtgcgcagattttcgagcaatccccgatgacgtgcatcgaaccgcatcaa
aacggttggctggtttacacgcccgaaggcagcgtcgagtgcaaaaatgtggtctatgct
gtcaatacttatgcaggtttgaacccgatattccggcctttggaacgcaaggcgattgct
gtcagcacctttattattgcgaccgaacccttgggggcgcgcgcaaaagggcttatccgt
aacaatatggcagtatgcgacaaccgccatattttggattattaccgcctcagcgcggac
ggcagactgcttttcggcggtaaggataacgagtttatcgacaatcctgagcgtatgacc
gagcttgtccgccaagatatgcttaaagtttttccgcagcttgccgatgtcaaaatcgaa
tattcgtggggcggggagtgcgacattaccgccaaccttgtcccgcatttcggacgttta
gccccgaatgttttttatgcgcaaggttattccggacacgggatggcgataacaggcatt
gcaggtctggcggttgccgaagcaattttaggggacgaatgccgtctgaagccgtttgag
cggttgcgccagccgaatattatcctgcaaccgtttttgcgcaaactcggttctttcctc
ggctcgaaatattatcagtggaaagacagccgttaa

DBGET integrated database retrieval system