KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0615Help
Entry
NMB0615           CDS       T00027                                 

Definition
(RefSeq) ammonium transporter AmtB
  KO
K03320  
ammonium transporter, Amt family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(645072..646376)
Genome map
AA seq 434 aa AA seqDB search
MKKHIWAASLLPASLSAEPLNWWKPYSAVNSGDTAWVMTAAALVLLMTLPGLALFYGGMV
RKKNLLSTMMHSFSIATLVGILWVAVGYSLAFTPGNAFIGGLGRVFLSGMQIDATAQMLT
VSPNAPTVPEPVFMFFQMTFAIISTAIITGAFAERMKYSAMMLFSGIWFLLVYVPGAHWV
WGGGFMSKGGVLDYAGGTVVHINAGIAGLVAALVLGRRIGYGREAMPPHNMAMTLIGAAM
LWFGWFGFNAGSALAADAAAGMAMAVTQVSAVFGAAGWLACEKIAGHKPSALGLASGAVS
GLVGITPAAGFTGPSGAAAIGILTAAACFVSVTVVKHKLRYDDSLDAFGIHGFGGLVGGI
LTGIFFDNRIFGGDAAVWQQLWIQVKDGVVMAAYSGLMSWAILKVVGKICGGLRVGKDVE
REGLDLNIHGERVE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacatatgggcggcatctttgctgccggcatccctatcggcagaaccttta
aactggtggaagccttattccgccgtcaattcgggcgataccgcctgggtgatgactgcg
gctgccttggtactgttgatgacgcttcccgggctggctttattctacggcggtatggtg
cggaaaaaaaacctgctctcgacgatgatgcacagcttttccatcgcgacattggtgggc
atcctttgggtcgccgtcggctattctttagcgttcacgccgggaaatgcctttatcggc
ggtttggggcgcgtatttttaagcgggatgcagatagacgctaccgcacagatgctgacc
gtgtcgcccaatgcgccgactgttcccgaaccggtatttatgttttttcagatgacgttt
gccattatttcgaccgccattattaccggcgcgtttgccgaacggatgaaatattcggca
atgatgctgttttcgggcatatggtttttattggtttatgtgccgggcgcgcattgggtg
tggggcggcggctttatgagcaagggcggcgtattggattatgccggcggtacggtggtg
cacatcaatgccggtatcgcgggactcgtcgccgccttggttttgggcaggcgcataggc
tacgggcgcgaggcgatgcctccgcacaatatggcgatgacactgatcggcgcggcaatg
ttgtggttcggctggttcggctttaacgccggatcggcgcttgcggcagacgcggcggcg
ggtatggcgatggcggtaacgcaggtgtcggccgtattcggcgcggcaggctggcttgcc
tgcgaaaaaatagcgggacacaaaccttccgctttggggctggcttccggcgcggtttcc
ggtctggtcggcatcacccctgccgccggctttaccggcccgtcgggcgcggccgccatc
ggtatattgactgccgccgcgtgctttgtgtccgtcaccgtcgtcaaacacaaattgcgt
tacgatgattctttggacgctttcggcatacacggattcggcgggctggtgggcggaata
ttgaccggcatctttttcgacaaccgcattttcggcggggatgcggcagtttggcagcag
ttgtggatacaggtaaaagacggggtcgttatggcggcatacagcgggctaatgagttgg
gcgattttgaaggtcgtggggaaaatctgcggcggcctgcgcgtcggcaaggatgtcgaa
cgcgaaggtttggatctgaatatccacggcgaacgcgtggaataa

DBGET integrated database retrieval system