KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0627Help
Entry
NMB0627           CDS       T00027                                 

Gene name
hisI
Definition
(RefSeq) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0627 (hisI)
  Amino acid metabolism
   00340 Histidine metabolism
    NMB0627 (hisI)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     NMB0627 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(660940..661335)
Genome map
AA seq 131 aa AA seqDB search
MDKNLLEAVKFDEKGLVCAIAQDAETKRILMVAWMNAEALQKTVETGFAHYYSRSRQKQW
MKGEESGHTQKVRALRLDCDGDAIVMLIAQNGGIACHTGRESCFYKVWRGSAWETADAVL
KDEKEIYGSTH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaacctgcttgaagccgtcaaatttgacgaaaaaggtttggtttgcgccatc
gcccaagatgccgaaaccaaacgtattttaatggtggcgtggatgaacgccgaagccctg
caaaaaaccgtcgaaaccggctttgcccactattacagccgttcgcgccaaaaacaatgg
atgaagggcgaagagtcgggacacacgcaaaaagtccgcgcactgcgcctcgactgcgac
ggcgacgccattgtgatgctcatcgcccaaaacggcggcatcgcctgccacaccgggcga
gaaagctgcttttacaaagtctggcgtggcagcgcgtgggaaaccgccgatgccgtcctg
aaagacgaaaaagagatttacggcagcacgcactga

DBGET integrated database retrieval system