KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0629Help
Entry
NMB0629           CDS       T00027                                 

Gene name
hisA
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0629 (hisA)
  Amino acid metabolism
   00340 Histidine metabolism
    NMB0629 (hisA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     NMB0629 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(662146..662883)
Genome map
AA seq 245 aa AA seqDB search
MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPAETALHWFKQGARRLHLVDLNGAFAGVP
QNLPAIKDILAAVAKDIPVQLGGGIRDLKTIGQYLDLGLNDVIIGTAAVKNPDFVREACK
AFPGRIIVGLDAKDGMAAIDGWATVTGHHVIDLAKRFEDDGVNSIIYTDIGRDGMMSGVN
IDATVKLAQTVRIPVISSGGLTGLDDIRALCAAEKHGVAGAITGRAIYEGSIDFAQAQQL
ADSLD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgatacccgccatcgatttgaaagaaggacgctgcgtccgcctgaaacaaggg
ctgatggaagaggcgaccgtcttttccgattcgcccgccgaaaccgcgctgcactggttc
aaacaaggcgcgcgccgcctgcatctggtagatttgaacggcgcgtttgccggcgttccg
caaaacctgcccgccatcaaagacatccttgccgctgtcgccaaagacatccccgtacag
ctcggcggcggcatacgcgatttgaaaaccatcggacaatatttggatttgggcttaaac
gacgtgattatcggcacggcggcggtcaaaaaccccgacttcgtgcgcgaggcgtgcaaa
gccttccccggcaggattattgtcgggctggatgccaaagacggtatggccgccatcgac
ggctgggcaaccgtaaccgggcatcatgtaattgatttggcaaaacgctttgaagacgac
ggcgtcaacagcatcatctacaccgacatcgggcgcgacggtatgatgagcggcgtgaac
atcgacgcgacggtcaaactcgcccaaaccgtccgcattcccgtcatctcctccggcgga
ctgaccggcttggacgacatccgcgccctgtgtgccgccgaaaaacatggcgtagcaggc
gcgattaccggccgcgcgatttacgagggtagcatcgattttgcccaagcgcagcaactg
gcagattccctcgactaa

DBGET integrated database retrieval system