KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0630Help
Entry
NMB0630           CDS       T00027                                 

Gene name
hisH
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  glutamine amidotransferase [EC:2.4.2.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00340  Histidine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NMB0630 (hisH)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     NMB0630 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 DJ-1_PfpI Peptidase_C26 SNO
Motif
Other DBs
NCBI-GeneID: 902743
NCBI-ProteinID: NP_273673
UniProt: Q9K0H2
Position
complement(662916..663554)
Genome map
AA seq 212 aa AA seqDB search
MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTEIFLSGDPDRVSRADKVIFPGQGAMPDCM
AALKRDGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLGWFGGKVRRFERDLRDP
QGCRLKVPHMGWNTVRQTQNHPLFKDIPQDTRFYFVHSYYFAPENPETILGESDYPSPFA
CIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgccattatcgattacggtatgggcaacctgcattccgtattgaaatccgtc
cggacggcggggcagcttgccggaaaaaataccgaaatctttttaagcggcgaccccgac
cgcgtgtcccgcgccgacaaagtcatttttcccggtcagggcgcgatgcccgactgtatg
gcggcattaaaacgagacggtttggacgaggcagtcaaagatgccttaaaaaacaaaccg
tttttcggaatctgcgtcggcgcgcaacttttattcgaccacagtgaagaaggaaacacc
gacggcttgggctggttcggcggcaaagtcagacgctttgagcgcgacctccgcgacccg
cagggatgccgtctgaaagtcccgcatatgggctggaacaccgtgcgccaaacccaaaac
cacccgctgtttaaagatattccccaagacacgcgtttttacttcgtccacagctactat
ttcgcccccgaaaatcccgaaaccatattgggcgaaagcgactacccgtccccgtttgcc
tgcatcgtcggcaaagacaacgtattcgccacgcaatttcacaccgaaaaaagccacgat
gccgggctgacgatgttgaaaaactttttaaactggtaa

DBGET integrated database retrieval system