KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0631Help
Entry
NMB0631           CDS       T00027                                 

Definition
(RefSeq) phosphate acetyltransferase
  KO
K13788  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0631
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0631
   00640 Propanoate metabolism
    NMB0631
  Energy metabolism
   00680 Methane metabolism
    NMB0631
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB0631
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     NMB0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(663685..665187)
Genome map
AA seq 500 aa AA seqDB search
MAKVLIVPVSAGLDASAAAQAFAKALDAQIFQAVDATAETLLAQGKSDDWFDALVGKVAA
LDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSDNADADELANRVNLAKQFF
AAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKDVSVLAGREAKRLSPAQFRYN
LIDFARQADKRIVLPEGAEPRTVQAAAICHEKGIARCVLLAKREEVEAVAKERGISLPDS
LEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQDTVVLGTMMMAQNDVDGLVSGAVH
TTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDCAVNPNPTAQQLADIAIQSAD
SAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLAREKRPDLAIDGPLQYDAATVPGV
GKSKAPGSPVAGQATVLVFPDLNTGNCTYKAVQRNANVLSVGPLLQGLRKPVNDLSRGAL
VEDIVFTIALTAVQAKQMEG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtactcatcgtacccgtatctgccggactggacgcctccgccgccgcacaa
gcctttgcaaaagcactggacgcacaaattttccaagccgttgacgcaaccgccgaaacc
ctgctcgcgcaaggcaaaagcgacgactggttcgacgcactggtcggcaaagttgccgca
ctcgatgccgccaacctcgtcatcgaaggcatcgcgcccgatgccgacaaaatctacctc
gcaggcaaaaacgtcgaactggcattgtcccttgacgcggcagccgtcttcgccgtccgt
tccgacaacgccgatgccgacgaactggcaaatcgggtgaaccttgccaaacagttcttc
gccgccgcgccgggcgtattggaaggttttgtcgtggacggcgcggcagcctccgttgcc
gaagcggcagccgaaaaaaccggcctgaccttcttcggttcgagcgacgcgctgaaagac
gtatccgtattggcaggccgcgaagcaaaacgcctgtcgccggcgcaattccgctacaac
ctgatcgacttcgcccgccaagccgacaaacgcatcgtcctgcctgagggcgcagaaccc
cgcaccgtccaagccgccgccatctgccacgaaaaaggcattgcccgctgcgtcctgctt
gccaaacgcgaagaagtcgaagccgttgccaaagaacgcggcatcagcctgcccgactct
ttggaaatcatcgatcccgcctcattggtcgaacaatacgtcgagccgatgtgcgaactg
cgcaaatccaaaggcctgacacccgaagacgcgcgcaagcaactgcaagacaccgtggta
ctcggtacgatgatgatggcgcaaaatgatgtggacggtttggtatccggtgcggttcac
accaccgccaacaccatccgccccgctttgcaactgattaaaaccgcaccgggcgcaagc
ctcgtgtccagcgtattctttatgctgctgcccaaccaagtcctcgtcttcggcgactgc
gcggttaatccgaacccgaccgcgcaacagcttgccgacatcgccatccagtctgccgat
tccgcaaaagccttcggcatcgacccgaaagtggcgatgatttcctactccaccgtcaac
tccggcagcggccccgatgtcgataccgtcatcgaagcaaccaaacttgcccgggaaaaa
cgccccgacctcgccatcgacggcccgctgcaatatgatgcggcaaccgtgccgggtgtg
ggcaaatccaaagctccgggcagcccggtggcaggacaggcaaccgttttggtcttcccc
gacctgaacaccggcaactgcacctataaagccgtccaacgcaacgccaacgtcttaagc
gtcggcccgctgctgcaaggcctgcgtaaaccggtcaacgacctctcccgcggcgcactg
gtagaagatatcgtgtttaccatcgccctgactgccgttcaggcaaaacaaatggaaggc
tga

DBGET integrated database retrieval system