KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0633Help
Entry
NMB0633           CDS       T00027                                 

Gene name
fbpB
Definition
(RefSeq) iron(III) ABC transporter permease
  KO
K02011  
iron(III) transport system permease protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB0633 (fbpB)
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    NMB0633 (fbpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(666451..667968)
Genome map
AA seq 505 aa AA seqDB search
MSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAVELLFRPRMWDLLSNTLTMM
AGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLPLCIPAFVSCFTWISLTFRVEGFWG
TVMIMSLSSFPLAYLPVEAALKRISLSYEEVSLSLGKSRLQTFFSAILPQLKPAIGSSVL
LIALHMLVEFGAVSILNYPTFTTAIFQEYEMSYNNNTAALLSAVLMAVCGIVVFGESIFR
GKAKIYHSGKGVARPYPVKTLKLPGQIGAIVFLSSLLTLGIIIPFGVLIHWMMVGTSGTF
ALVSVFDAFIRSLSVSALGAILTILCALPLVWASVRYRNFLTVWIDRLPFLLHAVPGLVI
ALSLVYFSINYTPAVYQTFIVVILAYFMLYLPMAQTTLRTSLEQLPKGMEQVGATLGRGH
FFIFRTLVLPSILPGITAAFALVFLKLMKELTATLLLTTDDVHTLSTAVWEYTSDAQYAA
ATPYALMLVLFSGIPVFLLKKYAFK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctaaaaaaatacccatttggcttaccggcctcatcctactgattgccctaccg
cttaccctgccttttttatatgtcgctatgcgttcgtggcaggtcggcatcaaccgcgcc
gtcgaactgttgttccgcccgcgtatgtgggatttgctctccaacaccttgacgatgatg
gcgggcgttaccctgatttccattgttttgggcattgcctgcgcccttttgttccaacgt
taccgcttcttcggcaaaaccttttttcagacggcaatcaccctgcctttgtgcatcccc
gcatttgtcagctgtttcacctggatcagcctgaccttccgtgtcgaaggcttttggggg
acagtgatgattatgagcctgtcctcgttcccgctcgcctacctgcccgtcgaggcggca
ctcaaacgcatcagcctgtcttacgaagaagtcagcctgtccttgggcaaaagccgcctg
caaacctttttttccgccatcctcccccagctcaaacccgccatcggcagcagcgtgtta
ctgattgccctgcatatgctggtcgaatttggcgcggtatccattttgaactaccccact
tttaccaccgccattttccaagaatacgaaatgtcctacaacaacaataccgccgccctg
ctttccgctgttttaatggcggtgtgcggcatcgtcgtatttggagaaagcatatttcgc
ggcaaagccaagatttaccacagcggcaaaggcgttgcccgtccttatcccgtcaaaacc
ctcaaactgcccggtcagattggcgcgattgtttttttaagcagcttgttgactttgggc
attattatcccctttggcgtattgatacattggatgatggtcggcacttccggcacattc
gcgctcgtatccgtatttgatgcctttatccgttccttaagcgtatcggctttaggtgcg
attttgactatattatgtgccttgccccttgtttgggcatcggttcgctatcgcaatttt
ttaaccgtttggatagacaggctgccgtttttactgcacgccgtccccggtttggttatc
gccctatccttggtttatttcagcatcaactacacccctgccgtttaccaaacctttatc
gtcgtcatccttgcctatttcatgctttacctgccgatggcgcaaaccaccctgaggact
tccttggaacaactcccaaaagggatggaacaggtcggcgcaacattggggcgcggacac
ttctttattttcaggacgttggtactgccgtccatcctgcccggcattaccgccgcattc
gcactcgtcttcctcaaactgatgaaagagctgaccgccaccctgctgctgaccaccgac
gatgtccacacactctccaccgccgtttgggaatacacatcggacgcacaatacgccgcc
gccaccccttacgcgctgatgctggtattattttccggcatccccgtattcctgctgaag
aaatacgccttcaaataa

DBGET integrated database retrieval system