KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0637Help
Entry
NMB0637           CDS       T00027                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0637 (argH)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0637 (argH)
   00220 Arginine biosynthesis
    NMB0637 (argH)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     NMB0637 (argH)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB0637 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(670888..672264)
Genome map
AA seq 458 aa AA seqDB search
MHDKTWSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQMLKETGVLDEGDLADI
RRGMAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRL
WLRDQITVIQSLIQSLQTALLDLAEQNAETVMPGFTHLQVAQPVSFGHHMLAYVEMLGRD
NERMADCRCRVNRMPLGAAALAGTTYPIQREITAELLGFEQICQNSLDAVSDRDFAIEFT
AAASLVMVHLSRLSEELILWMSPRFGFIDIADRFCTGSSIMPQKKNPDVPELVRGKSGRV
IGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTADTLIDTLRIYADMMRGVTVKPDNMRAA
VMQGFATATDLADYLVKKGMPFRDAHEVVAQAVRHADQAGVDLSELPLEVLQGFSDLIAD
DVYGVLTPEGSLNARNHLGGTAPEQVRFQVKRWREMLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaaaacctggtccggacgtttcaacgaacccgtttccgaactcgtcaaacaa
tacaccgcctccatcggtttcgaccgacggcttgccgaatgggacatccaaggctcgctg
gcacacgcgcaaatgctgaaagaaaccggcgtgttggacgaaggcgatttggcggacatc
cgccggggtatggcggaaatcctcgaagaaatccgcagcggcaaaatcgaatggtcgtcc
gatttggaagatgtccatatgaacatcgaacgccgcctgaccgacaaaatcggcgacgcg
ggcaaacgcctgcacaccggccgcagccgcaacgaccaagtcgccaccgacatccgcctg
tggctgcgcgaccagattaccgttatacaaagcctgattcaaagccttcagacggcattg
ctggatttggcggaacaaaacgccgaaaccgtcatgccaggctttacccacctgcaagtc
gcccagcccgtcagcttcggacaccatatgctcgcctacgtcgaaatgctcggacgcgat
aacgaacggatggcggactgccgctgccgcgtcaaccgtatgccgctcggcgcagccgcc
cttgccgggacgacctacccgattcagcgcgaaatcaccgccgagctattgggctttgaa
caaatctgccagaactcgctcgatgccgtatccgaccgcgatttcgccattgagttcaca
gccgccgcctcgctggttatggttcacctgagccgcctgtctgaagaattgattttgtgg
atgagcccgcgtttcggctttatcgacatcgccgaccgtttctgcacaggttcgtccatc
atgccgcagaagaaaaaccccgacgtgcccgaactcgtgcgcggcaaatccggccgcgtc
atcggacaccttatcggtctgattaccctgatgaaatcccaacccttggcgtacaacaaa
gacaatcaggaagacaaagaacccttgttcgacaccgccgacacgcttatcgacacgttg
cggatttacgccgatatgatgcgcggcgtaaccgtcaaacccgacaatatgcgcgccgcc
gtgatgcagggcttcgctaccgccaccgacttggcggattatctggtcaaaaaaggcatg
cctttccgcgatgcccacgaagtcgtcgcccaagccgtgcgccacgccgaccaagcgggc
gtcgatttgagcgaactgccgctcgaagtcttacaaggtttcagcgatttgattgccgac
gacgtttacggcgtgctgacacccgaaggcagcttaaacgcccgcaaccacttgggcggt
accgcgccggaacaagtccgcttccaagtgaaacgctggcgggaaatgttggcttaa

DBGET integrated database retrieval system