KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0639Help
Entry
NMB0639           CDS       T00027                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0639
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     NMB0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(673180..673779)
Genome map
AA seq 199 aa AA seqDB search
MSEKPEKIVLASGNAGKLEEFGNLFKPYSITVLPQSAFGIPECPEPYPTFVENALAKARH
AAKYSGLPALADDSGICAAALNGAPGIHSARYAGDNPKSDTANNLKLAAELVGKADKSCC
YVCVLVFVRHKDDPRPIIAEGVWHGQWNDTPLGQNGFGYDPYFYLPEHGKTAAELDTEVK
NRESHRAQALAELLRKLAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaccggaaaaaatcgttttggcaagcggcaatgccggcaagctcgaagag
ttcggcaacttattcaaaccttacagcatcaccgtattgccgcaatccgcattcggcata
cccgaatgccccgaaccctatcccacctttgtcgaaaacgcgctggcaaaagcacgccat
gccgccaaatacagcgggctgcccgcactcgccgacgacagcggcatctgtgccgccgcc
ttaaacggcgcgccgggcatccattccgcacgttacgcgggcgacaatcccaaatccgat
accgccaacaacctgaaacttgccgccgaacttgtcggcaaggcagacaaaagctgctgc
tatgtctgcgtattggtttttgtccgccataaagacgacccgcgcccgattatcgccgag
ggcgtatggcacgggcagtggaacgacacgccgctcgggcaaaacggtttcggttacgac
ccgtatttttatctgcccgaacacggcaaaaccgccgccgaattggatacggaggtcaaa
aaccgcgaaagccaccgcgcgcaggcacttgccgaactcttacgcaaactcgccctttaa

DBGET integrated database retrieval system