KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0665Help
Entry
NMB0665           CDS       T00027                                 

Definition
(RefSeq) coproporphyrinogen III oxidase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(691407..692582)
Genome map
AA seq 391 aa AA seqDB search
MHTISFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGLPEAAYIDALLTDLQL
ELPNIWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPEAEITLEANPGTFEIEK
FQGFKDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTALKLFDKVNIDLMYALPN
QTVQTALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKGLPQDEAALDIEDAVHGALE
GAGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGKISYPDRIERTVRRRHPNDY
LALMQSQPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAAMLQERTGVPSAKIMAQIETA
RQKGLLETDPAVFRPTEKGRLFLNDLLQCFL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccatttcctttccaaaccgcacccgactcaccgccctgccgcccctgtcgctt
tacatccacatcccgtggtgcatcaaaaaatgcccgtattgcgacttcaattcccacagc
ctgaaaaacggattgcccgaagccgcctatatcgacgcgctgctgaccgatttgcagctt
gaattgcccaatatttggggcaggccggtggaaacgatctttttcggcggcggtacgccc
agcctgtttcaggcggaatcgattgaccgtttgttaagcggcgtgcgttcgctgttgcgc
ttgcagccggaagcggaaattaccttggaagccaatccggggacatttgaaatcgagaag
tttcaaggatttaaagacgcgggtattacgcggctttctatcggcgtacagagtttcaac
gacgatatgctctcaaggctggggcgcgtccacaacggtaaggaagccttaaccgctatc
gataccgccttgaaattatttgataaagtcaatatcgacttgatgtatgccctgccgaac
caaaccgttcagacggcattggacgacgtacaaaccgctatcgctacgggcgcaacccac
atcagcgcgtatcacctgacgatggaaccgaacacgccgttcggtcatacgccgccgaaa
ggtttgccgcaagacgaagccgccctcgacatcgaagacgcggtacacggcgcgctggaa
ggcgcgggttttgtccactacgaaacatcggcttttgcgaaaccagccatgcagtgccgc
cacaatttgaactactggcagttcggcgattatttaggcataggcgcgggcgcgcacggc
aaaatttcctatcccgaccgcatcgagcgcaccgtccgccgccgccaccccaacgactac
ctcgccttaatgcaaagccaaccgagtgaagccgtcgaacgcaaaaccgtcgctgccgaa
gatttgccgttcgaattcatgatgaacgccctgcgcctgaccgacggcgtacccgccgcg
atgttgcaggagcgcacgggcgtaccgagtgccaaaatcatggcgcaaatcgaaacggca
aggcaaaaaggcctgctggaaaccgaccctgccgtattccgcccgaccgaaaaaggacgc
ttgtttttaaacgatttgctgcagtgttttttatag

DBGET integrated database retrieval system