KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0666Help
Entry
NMB0666           CDS       T00027                                 

Gene name
ligA-1
Definition
(RefSeq) DNA ligase
  KO
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:nme00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NMB0666 (ligA-1)
   03410 Base excision repair
    NMB0666 (ligA-1)
   03420 Nucleotide excision repair
    NMB0666 (ligA-1)
   03430 Mismatch repair
    NMB0666 (ligA-1)
Enzymes [BR:nme01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     NMB0666 (ligA-1)
DNA replication proteins [BR:nme03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     NMB0666 (ligA-1)
DNA repair and recombination proteins [BR:nme03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     NMB0666 (ligA-1)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NMB0666 (ligA-1)
   MMR (mismatch exicision repair)
    DNA ligase
     NMB0666 (ligA-1)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMB0666 (ligA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(692639..695164)
Genome map
AA seq 841 aa AA seqDB search
MNPNSKHNTNFTNLLKPSDSDIKQFAAQHICRLTDLLNRYAYEYYTLDAPSVPDAEYDKL
FRELEALELNHPELKLPDSPTQRVGGEPLAGFAEVRHEVPMLSLTNAFSPQDENGVFDHA
EMYAFDQRVRDGLDGGNPEYVIEPKFDGLAISLLYRDGVLVQAATRGDGTTGEDVTQNIK
TVSNIPLRLHGENTPELIEVRGEVLMLKADFVALNKRQAENGQKPFANPRNAAAGSLRQL
DSRITAQRKLHFFPYSVARQQDGFVAEEHIQELAYFQALGFSLPNGNFGCFKNIDEVLAF
YEHMQQKRPELPYEIDGMVVKVNSLAQQHELGFISRAPRWAVAHKFPAEEALTIVEAIDV
QIGRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKDVRVGDTVVVRRAGDVIPEVVR
VIFERRPMRETAVAVSDGIGHRQDDLFAETPSANQTQSVPLHKPYRLPTHCPICRSEIER
EEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQDLVRHFADLYRL
DIPTLQKMKETADKTVAESDQMPSEGSSVGASGKHKKQPVKWAENILAGIEASKTPELAR
FLFALGIRHVGERTAKTLAQAFGTLERVRRAPEPVLACLPDIGTVVARSIAHFFAQAEQQ
AMIDELLAAGVAPQTQAVTIPPARHAEPQRWIARLPGFKISENKAQALWELAGKNIEGLQ
TDKALPTDWQAWRSEPQNAALLENLKTFFAQMPSEDEAAQGSDGINKAVAGKTFVLTGTL
PTLKRDQAQSLIEAAGGKVSGSVSKKTDYVVAGEAAGSKLEKANALGVSVLSEAELLTLL
G
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaactcaaaacataacactaactttaccaatcttcttaaaccgtctgatagt
gatataaaacaatttgccgcacaacacatctgccgcctcaccgacctcctcaaccgctac
gcctacgaatactacaccctcgacgcgcccagcgtacccgatgccgaatacgacaaattg
ttccgcgaactcgaagcgttggagttaaaccatcccgagctcaaactgcccgacagcccg
acccagcgcgtcggcggcgagcctttggcgggatttgccgaagtacgccacgaagtgccg
atgctgtcgctgaccaacgctttttccccgcaagatgaaaacggcgtgttcgaccatgcc
gaaatgtacgccttcgaccaacgcgtgcgcgacggcttggacggcggcaatcccgaatac
gttatcgaacccaaattcgacggcctcgccatcagcctgctctaccgcgacggcgtattg
gtgcaggcggcaacgcgcggcgacggcacgacgggcgaagacgttacccaaaacatcaaa
accgtatccaacatccccttgcggctgcacggcgaaaatacgcccgaactcatcgaggta
cgcggcgaagtgctgatgctcaaagccgattttgtcgccctcaataaaagacaagccgaa
aacgggcaaaaaccctttgccaatccgcgcaacgccgccgccggcagcctacgccaactc
gattcgcgcatcaccgcgcaacgcaaactgcactttttcccctactccgtcgcccgccag
caagatggtttcgtcgcggaagaacacatccaggaactcgcctatttccaagcactcggc
ttcagtctgcccaatggcaatttcggctgtttcaaaaatatcgacgaagtattggcgttt
tacgaacacatgcagcaaaaacgccccgaactgccctacgaaatcgacggcatggtcgtc
aaagtcaacagcttggcgcaacagcacgaactcggcttcatctcccgcgcgccgcgttgg
gcggttgcccacaaattccctgccgaagaagccctgaccattgtcgaagcgattgacgtg
caaatcggcaggacgggtgcggtaacgccggttgcccgattacagcccgtattcgtcggt
ggcgtaactgttaccaacgccaccctgcacaatcaggacgaagtatcgcgcaaagacgtt
cgcgtcggcgataccgtcgtcgtacgccgtgccggagacgtgattcccgaagttgtgcgc
gtgatttttgaacgccgcccgatgcgggaaaccgccgttgccgtttcagacggcatcggg
catcggcaggacgatttgtttgccgaaacaccgtccgccaatcaaacccaatccgttccg
ctccacaagccctaccgcctgccgacccactgccccatctgccgcagcgaaatcgaacgc
gaagaaggcgaagccgtcgcccgatgcagcggcggtatgctttgtcaggcacaacgcgcg
caaggcttaatccacttcgcctcgcgcaaagcgatggacatcgacggcttgggtgaaaaa
caaatcgaacagcttgtcgcgcaagacctcgtccgccacttcgccgatctctaccgcctc
gacatcccgaccttgcaaaaaatgaaggaaacagcggacaaaaccgttgccgaatcggat
caaatgccgtctgaaggcagttcggtcggcgcgtcgggcaaacataaaaaacaaccagtc
aagtgggcggaaaacatcctcgcaggcatagaagccagcaaaacgcccgaactcgcccgc
ttcctgttcgcgctcggcatccgccacgtcggcgaacgcaccgccaaaacgctggcacag
gcattcggcacattggaacgcgtccgccgcgcccccgaacccgtcctcgcctgcctgccc
gacatcggtacggtagtggcgcgttccattgcccacttcttcgcccaagccgaacagcag
gcgatgatagacgaactgctcgccgcaggcgttgccccgcaaacccaagccgttaccatc
ccgcccgcccgccacgccgaaccgcaacgctggatcgcccgcctgcccggtttcaaaatc
agcgaaaacaaagcccaagccttatgggaactcgccggcaaaaacatagaagggctgcaa
accgacaaagccctccccaccgactggcaggcgtggcgcagcgaaccacaaaacgccgcc
ctgctcgaaaacctgaaaaccttcttcgcgcaaatgccgtctgaagacgaggcggcgcaa
ggttcagacggcatcaataaagccgtggcgggcaaaaccttcgtgttaaccggcaccctg
cccaccctcaaacgcgaccaagcccaatccctaatcgaagccgcaggcggcaaagtttcc
ggcagcgtgtccaaaaaaaccgattacgtcgtcgccggagaagccgcgggcagcaagctg
gaaaaagccaatgccttgggcgtttccgtcctcagcgaagccgaactgcttaccctgctc
ggctga

DBGET integrated database retrieval system