KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0668Help
Entry
NMB0668           CDS       T00027                                 

Gene name
ampD
Definition
(RefSeq) N-acetyl-anhydromuranmyl-L-alanine amidase
  KO
K03806  
N-acetyl-anhydromuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     NMB0668 (ampD)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   NMB0668 (ampD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(696816..697388)
Genome map
AA seq 190 aa AA seqDB search
MDNHAEAHWQNGWLQSIRHTPSPNFSPRETGETVSLIVLHNISLPPFEYGTDAVEKLFAN
RLDPDGHPFFSLIHTLRVSSHFLIKRDGETVQFVSCDNMAYHAGVSSFGGREKCNAFSIG
IELEGCDFEPFAEAQYRSLEALLDAICRHYPVTAVTGHQDIAPGRKTDPGHFFDWRRIRE
KGFLVDRNAV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcacgccgaagcacactggcaaaacggctggcttcaaagcatacgccatacc
ccgtcgcccaatttcagcccgagggaaacgggggaaacggtttccctgatcgtgttgcac
aacatttcgctgccgccgttcgaatacggcacggatgcggtggaaaagctgtttgccaac
cggctcgaccccgacggacatccgttcttcagcctgatacacactttgcgcgtatccagc
catttcttaatcaaacgcgacggagaaacggtacagttcgtttcctgcgacaatatggca
taccatgccggcgtatcttcattcggcggcagggaaaaatgcaacgcattttcaatcggc
atcgaactggaaggctgcgatttcgaaccgtttgccgaagcgcaataccgttcgctcgaa
gccttgttggacgcaatctgccgccactaccccgtcacggcggtaacggggcaccaagac
atcgcgcccggccgcaaaaccgaccccggccattttttcgactggcggcggatacgggag
aaagggtttctcgtggacagaaatgccgtctga

DBGET integrated database retrieval system