KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0670Help
Entry
NMB0670           CDS       T00027                                 

Gene name
tmk
Definition
(RefSeq) thymidylate kinase
  KO
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0670 (tmk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     NMB0670 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
698527..699147
Genome map
AA seq 206 aa AA seqDB search
MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKA
GLRAETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEH
WVQGGLKPDLTLLLDVPLEVSMARIGQTREKDRFEQEQADFFMRVRGVYLDRAAACPERY
AVIDSNRNLDEVRNSIEKVLDGHFGC
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcaattcatcactttggacggcatagacggtgccggcaaatccaccaacctt
gccgtcatcaaggcatggtttgaacggagggggctgcccgtgctgttcacgcgcgagccg
ggcggaacgccggtcggtgaggccttgcgcgaaatcctgctcaaccctgaaaccaaagcc
ggtttgcgtgcggaaaccctgatgatgttcgccgcgcgtatgcagcacatcgaggaagtc
atcctgcccgcgctttcagacggcatacacgtcgtgtctgaccgttttaccgacgcgacc
ttcgcctatcagggcggcgggcgggggatgccgtctgaagacattgaaattttggaacat
tgggtgcagggcggtttgaagccggatttgaccctgctgctggatgtgccgctcgaagtg
tcgatggcgcgtatcgggcagacgcgcgagaaagaccgtttcgagcaggagcaggcggat
ttctttatgcgtgtgcgcggcgtttatctcgaccgagccgccgcctgtcccgaacggtac
gccgttatcgacagtaaccgcaacttggatgaagtcagaaacagcatagaaaaagtgttg
gacggacatttcggctgctga

DBGET integrated database retrieval system