KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0672Help
Entry
NMB0672           CDS       T00027                                 

Gene name
lpxK
Definition
(RefSeq) tetraacyldisaccharide 4'-kinase
  KO
K00912  
tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0672 (lpxK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.130  tetraacyldisaccharide 4'-kinase
     NMB0672 (lpxK)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0672 (lpxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
701196..702230
Genome map
AA seq 344 aa AA seqDB search
MPNCFKFHTVIERHWQKPYPVLSFLLKPLSGLFAKIAAKRRTDFLSGKRQSEKLPVPVVV
VGNIHAGGTGKTPIVAALVSGLQEKGVKVGIISRGYGRKSKAVHVLNAESRAEDAGDEPL
LLFRKTGAPTAVGSSRAEAGRALLAAHPDIGLIVADDGLQHYALRRDVEIAVFPAADTGR
TDLDLLPNGSLREPLLRLDSVDAVVVSGGKADALFRPSENMFHSRIEAGRIYRLNNPSEI
LDTGRLKNQTVVAVAGIAKPARFFDSLRNMGITVKRTVALPDHADISAADLPDADAVIIT
EKDAVKFSDGICTDNVWVLPVCAIIEPDLAAFVLERLEDVPKAV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgaattgtttcaaatttcataccgttatcgaacggcattggcaaaaaccttatccg
gttttgtcttttctgcttaagccgctctccgggctgtttgccaaaattgcggcaaaacgg
cggacggattttttatcgggaaaacggcaaagcgaaaagctgcccgtgcctgtggtcgtg
gtcggcaatattcacgcgggtgggacggggaaaacgccgattgttgccgcgctggtgtcg
ggtttgcaggaaaagggcgtcaaggtcggcatcatcagccggggctacgggcgcaagagc
aaggcggttcatgtattgaatgctgagagccgagcggaagatgcgggcgatgagcctttg
ctgctgttccgcaaaaccggtgcgccgacggcggtgggcagcagccgtgcagaggcaggc
agggcgttgctggcggcgcatcccgacatcggactgattgtggcggacgacggtttgcag
cattacgccctgcggcgagatgtggaaatcgcggtgtttccggcggcggatacggggcgc
acggatttggatttactgcccaacggcagtttgcgcgaacctttgttgcggctggattcg
gtggatgcggtcgtcgtcagcggcggcaaggcggatgcgctgtttaggccgtctgaaaat
atgtttcacagccgtatcgaagcgggacggatttaccgtttgaacaatccgtccgaaata
ctggacacaggccgtctgaaaaatcaaaccgtcgtcgccgtggcaggtattgccaagccg
gcgcggttttttgattcgttgcggaatatgggcattaccgtgaagcgaaccgtcgcgctg
cccgaccacgccgacatttcggcggcagatttgcccgatgcggacgcggtcattattacg
gagaaagatgcggtcaaattttcagacggcatttgcaccgataatgtttgggtgttgccc
gtttgtgcgataatcgaacctgatttggcggcgtttgtgttggagcggttggaagatgta
ccgaaggccgtctga

DBGET integrated database retrieval system