KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0675Help
Entry
NMB0675           CDS       T00027                                 

Gene name
kdsB
Definition
(RefSeq) 3-deoxy-manno-octulosonate cytidylyltransferase
  KO
K00979  
3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0675 (kdsB)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.38  3-deoxy-manno-octulosonate cytidylyltransferase
     NMB0675 (kdsB)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB0675 (kdsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
703265..704026
Genome map
AA seq 253 aa AA seqDB search
MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAARVVVATDHPDIQTACQ
AHGIEVVMTSNRHESGTTRLAEASVALKLPPHLIVVNVQGDEPLIAPELIDRTAEVLVEN
NVQMATAAHELHDFDELMNPNAVKVVLDKNRNAIYFSRAPIPYPRDAIRAGKREMPSETA
VLRHIGIYAYRAGFLQRYAEMSVSPLETIESLEQLRVLWHGYPIAVETAKEAPAAGVDTQ
EDLDRVRAVFQTV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcgtcgtattgattccggcgcggctggattcgtcgcgcctgcccggaaaa
gccttggcggacatccacggcaaaccgatggtcgtgcgcgttgccgaacaggcggcaaaa
agtaaagccgcgcgcgtcgtcgttgccaccgaccatcccgatattcagacggcctgtcag
gcgcacggtatcgaagtcgtcatgacttcaaaccggcacgaaagcggcacgacgcgcctt
gccgaagcctctgtcgcgctgaagctgccgccgcatttgattgttgtgaacgtacagggt
gacgagccgctgattgcccccgaactcatcgaccgcaccgccgaagtactcgtcgaaaac
aacgtccaaatggcgaccgccgcccacgaattgcacgatttcgacgaattgatgaatccc
aacgccgtcaaagtcgtcctcgacaaaaaccgcaacgccatctacttcagccgcgccccg
attccctatccgcgtgatgcgatacgtgccggaaaacgcgaaatgccgtctgaaaccgcc
gtcctgcgacatatcggcatctacgcttaccgcgccggcttcctgcaacgctatgccgaa
atgagcgtttcgccgctggaaaccatcgaatcgctggaacagctgcgcgtcctgtggcac
ggttatcccattgccgtcgaaaccgccaaagaagcccccgccgccggtgtggatacgcaa
gaggacttggacagggttcgcgccgtatttcagaccgtataa

DBGET integrated database retrieval system