KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0678Help
Entry
NMB0678           CDS       T00027                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0678 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0678 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0678 (trpA)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMB0678 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
705342..706127
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIAYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIEN
NTGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattgcctat
attacggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
aacggtgcggatattttggagttgggtgtgccgttttccgatccgatggcggatgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagtgcacgcaaa
atcggccgggttgccgacgcagttattgtcggcagccggattgtgaaagaaatcgaaaac
aatacaggcaacgaggctgccgccgtcggtgctttggtaaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system