KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0682Help
Entry
NMB0682           CDS       T00027                                 

Gene name
pyrC
Definition
(RefSeq) dihydroorotase
  KO
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0682 (pyrC)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     NMB0682 (pyrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
708404..709438
Genome map
AA seq 344 aa AA seqDB search
MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPPVVSVADALAYKARIM
AALPEGSAFEPLMTLYLTDNATPELVREAKAAGIVAFKLYPAGATTNSDSGVTDLFKLIP
VLEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPVLAQVPNLKVVFEHITTAEAA
RLVLEAGDNVAATVTPQHLLLNRNDLLVGGVRPHHFCLPVLKRETHRQALVAAVTGEKAH
KFFLGTDSAPHAKSAKENACGCAGMFSAMTAIELYAEVFEKAGALDKLEAFASKNGARFY
GIPENTDTITLVKQSQTVPASVPYGDGELVPMRAGGEIGWTVQY
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctgaccattatccgccccgacgatatgcacctgcacctgcgcgacggcgac
gcgctcaaagccgttgccccttataccgcccgccaaatggggcgcgccgtcattatgccc
aacctcaaaccgcctgtcgtcagtgtagccgacgcgcttgcctacaaagcgcgcattatg
gcggcgttgcccgaaggtagcgcgtttgagccgttgatgacgctttatttgactgataac
gccacgcccgaacttgtacgcgaagccaaagccgccggcatcgtcgccttcaaactctac
cctgccggcgcgaccaccaattccgattccggcgtaaccgacctgttcaagctcatcccc
gtgttggaagaaatggcgaaacagggcattttgttcctcgttcacggcgaagtaaccgac
cccgaaatcgacatcttcgaccgcgaagccgcctttatcgggcgcgtgatgaaacccgtt
ttggcgcaagtgccgaatcttaaagtcgtgttcgaacacatcaccaccgccgaagccgcc
cgcctggttttggaagcaggcgacaacgtagccgccaccgttaccccgcaacacctcctg
ctcaaccgcaacgacctcttggtcggcggcgtgcgcccccatcatttctgcctgcccgta
ctcaaacgcgaaacccaccgtcaggcattggtcgccgccgttaccggcgagaaggcgcat
aaattcttcctcggcaccgactccgcgccgcacgccaaatccgccaaagaaaacgcctgc
ggctgcgccggtatgttcagtgcgatgaccgctatcgagctttacgccgaagtatttgaa
aaagcaggcgcgttggacaaactcgaagccttcgcctcaaaaaacggcgcaaggttctac
ggcattcctgaaaataccgacacgatcaccctcgtcaaacaaagccaaaccgttcccgca
agtgttccctacggcgacggcgaacttgtcccgatgcgcgcgggcggcgaaatcggctgg
acggtgcagtattga

DBGET integrated database retrieval system