KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0688Help
Entry
NMB0688           CDS       T00027                                 

Gene name
trpF
Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0688 (trpF)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0688 (trpF)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NMB0688 (trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(714856..715482)
Genome map
AA seq 208 aa AA seqDB search
MRKIRTKICGITTPEDAAAAAAAGADAVGLVFFQGSSRAVDIARAKKITAALPPFVSVVA
LFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFHRPYIKAIRVQTASDIRNAATRFP
DAQALLFDAYHPSEYGGTGNRFDWTLLAEYSGKPWVLAGGLTPENVGEAVRITGAESVDV
SGGVEASKGKKDAAKVAAFIATANRLSR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaatccgcaccaaaatctgcggcatcaccacaccggaagacgcagctgccgcc
gcagcggcaggtgcggatgccgtcgggctggtctttttccaaggcagcagccgggccgtc
gatattgcccgcgccaaaaaaatcaccgccgcactgccgccgtttgtcagcgttgtcgcc
cttttcgtcaacgaaagcgcgcaaaacatccgccgcatccttgccgaagtgccgatacac
atcatccaattccacggcgacgaagacgacgcattctgccgccagttccaccgcccctat
atcaaagccattcgtgttcagacggcatcagacatccgaaacgccgccacgcgcttcccc
gacgctcaggcactgctgttcgatgcctaccatccttcggaatacggcggcaccggaaac
cgcttcgactggacgctgctggcggaatattcgggcaaaccgtgggtgcttgccggcggg
ctgacccctgaaaacgtcggcgaagccgtccgcatcaccggagcggaatcggtcgatgta
tccggcggtgtggaagcgtctaaaggcaaaaaagatgccgccaaagtcgccgcctttatc
gcaaccgccaaccgcctatcccgttaa

DBGET integrated database retrieval system