KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0690Help
Entry
NMB0690           CDS       T00027                                 

Gene name
purF
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  
amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0690 (purF)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0690 (purF)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     NMB0690 (purF)
Peptidases [BR:nme01002]
 Cysteine Peptidases
  Family C44
   NMB0690 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(716132..717676)
Genome map
AA seq 514 aa AA seqDB search
MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMHKGKGMVREVFRTRNM
RDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGNLTNTAELYENVCNKHL
RHVNTSSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVAQVHRLVRGAYGVIAMIA
GYGMLAFRDPYGIRPLVLGSQTDSEGRKSYAVASESVAFNALTYDLERDIRPGEAVFVGF
DGTMIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSRLDMGVSLAEKIKRELPVDG
IDVVMPIPDTSRPSAMELAVHLDKPYREGLIKNRYIGRTFIMPGQATRKKSVRQKLSPME
TEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIASAAPEVRYPNVYGIDMPTREE
LIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPKIESFDSSCFNGIYQTGDIDDAY
LDRLSAEKSGCGGLKIHPSRMEHSISISDAGDEE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtattaggtttggtcagtcatgaacccgtgaaccagcttctgtacgacggc
ttgcagatgttgcagcacagggggcaggatgcggcgggcattgcaacggcggaaggcggt
accttccatatgcacaaaggcaaaggcatggtgcgcgaagtgttccgcacacgcaatatg
cgcgatttgaccggcaacgccggcatcgcccacgtccgttatcctactgcgggcaacgca
ggcagcagcgcggaggcgcagcctttctacgtcagctcgccgttcggcatcgttttggcg
cacaacggcaacctcaccaacactgccgaactgtatgaaaacgtgtgtaacaaacacctg
cgccacgtcaacaccagctccgattccgaagtcttgctcaacgtattcgcgcacgaatta
cgccgcgaagtctctaaaaacgccgacccgcaccggctcaatgccgacaatattttcaac
gccgttgcccaagtccaccgcctggtgcgcggcgcatacggtgtgattgccatgattgcg
ggctacggtatgctcgccttccgcgacccttacggcatccgcccgctggtattgggttcg
caaaccgacagcgaaggcagaaaatcctatgccgtcgcctccgaatccgtcgccttcaac
gcgcttacctacgatttggaacgcgacatccggccgggcgaagcggtatttgtcggcttt
gacggcacaatgattgcccgccaatgcagcgaccgtgccaaactcagcccctgccttttt
gaatatgtttattttgcccgccccgactctgtgattgacggcgtatccgtttaccaatcg
cgcttggatatgggcgtgtcgctggcggaaaaaatcaaacgcgagctgcccgtggacggc
atcgatgtcgtgatgcccattcccgacaccagccgccccagcgcgatggagcttgccgtc
catctcgacaaaccctaccgcgagggtttgattaaaaaccgctatatcggccgcaccttt
attatgcccggacaggcgacgcgcaaaaaatccgtgcgccaaaaactcagcccgatggaa
accgaatttgcaggcaaaagcgtgttgctggtggacgactccatcgtgcgcgggacgacc
agccgcgaaatcgtcgaaatggtacgcgcggcgggcgcgcgcaaagtctatatcgcctcc
gccgcgcccgaagtgcgctatcccaatgtgtacggcattgatatgcccacgcgcgaagag
ttgattgccaacgggcgcagcgcggcggaaatcgccgccgaaatcggcgcggacggcatc
gtatttcaagacttgggcgatttggaagccgtcgtcaaagcactcaatccgaaaatcgaa
tccttcgattcgtcctgtttcaacggcatttatcagaccggcgacatcgatgatgcctac
ctcgaccgcctgtctgccgagaaatccggctgcggcggtctgaaaatccacccgagcagg
atggaacacagcatcagcatcagcgatgcgggcgacgaagaataa

DBGET integrated database retrieval system