KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0693Help
Entry
NMB0693           CDS       T00027                                 

Gene name
folC
Definition
(RefSeq) bifunctional folylpolyglutamate synthase/dihydrofolate synthase
  KO
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB0693 (folC)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     NMB0693 (folC)
    6.3.2.17  tetrahydrofolate synthase
     NMB0693 (folC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(719490..720764)
Genome map
AA seq 424 aa AA seqDB search
MKTLQDWLSHLETAHSGGLIDMGLERTSEVKKRMKLEPQCPVVVVAGTNGKGSVCAYLTQ
IYKQAGYKIGTLTSPHLLRYNERIAINAEPVSDDTIIASFERIEAARGEISLTYFEFNAL
AAVDIFMREQVDVMILEVGLGGRLDAVNAFDGDCAVVTSVDLDHQAFLGDTVEQVGFEKA
GVFRSGKPAICGQNPAPKSLLSHAEAIGAKLLMVQRDFEFHAMENIQWNYRFRPQHSDDP
ARNRNALPFPALRGTYQLSNAACALTVLECLNDKLPVDIGAIKRGLLLVENPGRFQVLPG
RPLTVLDVGHNPHAARALRRSLINLAFAQKRTAVFSMLSDKDIDGVLETVKDQFDEWYIA
PLDVPRGMTLESLQNKLHEHSIENIQTFAAVREAYRAAASKAGENDRIVVFGSFHTVADV
MSVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactacaagactggctctcgcatttggaaaccgcccacagcggcggtttgatc
gacatgggtttggagcgcacgagcgaagtgaaaaaacgcatgaagctcgagccgcaatgc
cccgtcgtcgttgtcgcgggaaccaacggcaaaggttcggtctgtgcctacctgacacag
atttacaaacaggcgggctacaaaatcggtacgctgaccagcccgcatttattgcgttac
aacgaacgcatcgccatcaacgccgaacccgtttcggacgatacgattattgcctctttc
gagcgcatcgaagccgcgcgcggcgaaatatcactgacttattttgaattcaatgccttg
gcggctgtcgacatcttcatgcgcgaacaggttgacgtgatgatattggaagtcggcttg
ggcggccgcttggacgcggtcaacgcgtttgacggcgattgcgcggtggttaccagcgtg
gatttggaccatcaggcatttttgggcgatacggtcgagcaggtcggctttgaaaaagca
ggcgtgttccgtagcggcaaacccgccatctgcggtcaaaaccccgcgcccaaatcgttg
ctttcacacgccgaagccataggcgcgaaactgctgatggtgcagcgcgatttcgagttt
cacgcgatggaaaacatccaatggaactaccgcttccggccgcaacattcagacgacccc
gcgcgcaaccgcaatgccctgcccttccccgcattgcgcggcacataccagctttccaat
gccgcctgcgcgctgaccgtattggaatgcttgaacgacaaattgccggtggacatcggt
gccatcaagcgcggtttgttgctggttgaaaatcccggacgcttccaagtcctgcccggc
cggccgctgaccgttttggatgtcggacacaatccccacgccgcccgcgccctgcgccgc
agcctgattaatttggcgtttgcgcaaaaacgcaccgccgtgttcagcatgttgtccgac
aaagacatagacggcgtgttggaaaccgttaaagaccagtttgacgagtggtatatcgca
ccgttggatgtaccgcgcggcatgacgctcgagagcctgcaaaacaaactgcacgaacac
agcatcgaaaacatacaaacattcgccgccgtccgcgaagcataccgggcggcagcctca
aaagcgggcgagaacgacagaatcgtcgttttcggctcatttcataccgttgccgatgtc
atgtcggtactttaa

DBGET integrated database retrieval system