KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0718Help
Entry
NMB0718           CDS       T00027                                 

Gene name
hemH
Definition
(RefSeq) ferrochelatase
  KO
K01772  
protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0718 (hemH)
Enzymes [BR:nme01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     NMB0718 (hemH)
    4.99.1.9  coproporphyrin ferrochelatase
     NMB0718 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(748528..749610)
Genome map
AA seq 360 aa AA seqDB search
MPSEAASDGILPLYPTRTIFQKPIMLPFFPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAV
RPYLKSFLTDRRVVELPKWLWYPILHGLVLTLRPKKSAHAYEKIWFKEGSPLEVYTARQA
AALAKRMPDLIVRHAMTYGNPSVADVLSELKAQGAGRLLVIPMYPQYAASSSGAAVDKVC
EQLLLQRNQMSVRTVSRFYDDTGYIDAMKNHILRYWAEHGRGKKLMLSFHGVPQKHHDLG
DPYPDECRHTAKLLAEALELTEDQYVVSFQSQFGRAKWVTPSTQDLFGKLPKQGVTELDV
FCPGFLADCLETMEEIALMGREQFYEAGGKSYRYIPCLNDNPDWIDALVALAEENLGSWR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccgcttcagacggcattttgccgctttaccctacccgcactattttt
cagaaaccgatcatgcttccattctttccagaaccctccctttcctatacgcaacaaaac
cgtaccgccgttttgctgttgaacctcggcacgcccgacgcgccgaccgcgcaggcggta
cgaccttatctgaagtcctttctgaccgaccggcgcgtcgtcgaactgcccaaatggctg
tggtatcccattctgcatggtctggtactgacgctccgccccaaaaaaagcgcgcacgcc
tatgaaaaaatctggtttaaggaaggttcgcccttagaagtttacacagcacgccaagct
gccgcgcttgccaaacgtatgcccgacctcatcgtccgccacgccatgacctacggcaat
ccttcggtggcagacgtattgtcggaactgaaggcgcaaggcgcgggcagactgctggtc
atcccgatgtacccgcaatatgccgcttccagcagcggagcggcagtagataaggtgtgc
gaacaattactgctgcaacggaaccaaatgagcgtccgcaccgtttcgcgcttttatgac
gataccggctacattgatgcgatgaaaaaccacatcctccgatattgggcggaacacggg
cgcgggaaaaaactgatgttgagttttcacggcgtaccgcagaagcaccacgacctcggc
gacccctatcccgacgagtgccgccacaccgccaaactgcttgccgaagcactggaactg
accgaagaccaatatgtcgtatcgttccaaagccaattcggcagggcaaaatgggttaca
ccgagcacgcaggatttgttcggcaaactgcccaaacagggggtaaccgagctggacgta
ttttgcccgggctttttggcagactgtttggaaaccatggaagaaatcgccctgatgggg
cgggaacagttttatgaagcaggcggcaaaagctaccgctacatcccctgcctcaacgac
aaccccgactggatagatgcactcgtcgcacttgccgaagaaaaccttggcagctggcgt
tga

DBGET integrated database retrieval system