KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0732Help
Entry
NMB0732           CDS       T00027                                 

Gene name
bioA
Definition
(RefSeq) adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA
  KO
K00833  
adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0732 (bioA)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     NMB0732 (bioA)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class III
   NMB0732 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
763597..764898
Genome map
AA seq 433 aa AA seqDB search
MPSEHQHISSLLDFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIELADGTRLIDGMSSWWC
AIHGYNHPVLNQAVETQMKQMAHVMFGGLTHEPAVELGKLLVGILPQGLNRIFYADSGSI
SVEVALKMAVQYQQARGLTAKQNIATVRRGYHGDTWNAMSVCDPETGMHHIFGSALPQRY
FVDNPKSRFDDEWDGADLQPVRALFEVHHADIAAFILEPVVQGAGGMYFYHPQYLRGLHD
LCDEFDIMLIFDEIATGFGRTGKMFACEHAEVVPDIMCIGKGLSGGYMTLAAAITSQKVT
ETISRGEAGVFMHGPTFMANPLACAVACASVKLLLSQDWQANIRRIESILKGRLKAAWDI
RGVKDVRVLGAIGVIELEKGVDMARFQADCVAQGIWVRPFGRLVYLMPPYIISDGVLTKL
ADKTVQILKEHSK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaacatcaacacatatcatcattgcttgatttcgaccgtacccatctgctt
catccctatacttccatgaccgatccgctgcccgtttatcctgtcaaacgtgcagaaggg
gtgtttatcgaattggcggacggcacgcggctgattgacgggatgtcctcctggtggtgt
gcgatacacggctacaatcatcctgttttgaatcaggcggttgagacgcagatgaaacaa
atggcgcacgtgatgttcggtggtttgacgcacgagccagcggtggagctgggcaagttg
ttggtcgggattttgccgcaggggctgaaccgtattttttatgcggattcgggttcgatt
tcggtggaagttgcgctgaagatggcagtgcaataccagcaggcgcggggtttgacggcg
aagcagaatatcgcgacggtgcgccgcgggtatcacggcgatacttggaacgcgatgtcc
gtctgcgatccggaaacggggatgcaccatattttcggcagcgcgttgccgcagcgttat
tttgtcgataatccgaaaagccgtttcgacgatgaatgggacggggcggatttgcagcct
gtccgcgccttatttgaagtgcatcatgcggatattgccgcctttattttagagccggtc
gtgcagggcgcgggcggcatgtatttttatcatccgcagtatcttcgcggattgcacgat
ttgtgcgacgaatttgatatcatgctgatttttgacgaaatcgccactggattcgggcgc
acgggcaagatgtttgcctgcgaacacgcggaggtcgtgccggatattatgtgtattggc
aagggtttgagcggcggctatatgacgctggcggcagcaatcacttcgcaaaaagttacc
gaaacgatttcgcgcggcgaagcgggcgtgtttatgcacggcccgacgtttatggcaaac
ccgctggcgtgtgccgttgcctgcgcttcggtcaaactgcttttgtctcaagactggcag
gcaaatatccgccgcattgaaagcatcttaaaaggccgtctgaaagccgcgtgggacatt
cgcggcgtgaaagacgtgcgcgttttaggtgccatcggggtgatcgagctggaaaaaggc
gtggatatggcgcgttttcaagcggactgcgtggcgcagggcatttgggtgcgcccgttc
ggcaggctggtgtatctgatgccgccctatatcatttcagacggcgttttgaccaaactt
gccgacaaaaccgtgcaaatcttgaaggaacacagcaaatga

DBGET integrated database retrieval system