KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0733Help
Entry
NMB0733           CDS       T00027                                 

Gene name
bioD
Definition
(RefSeq) dithiobiotin synthetase
  KO
K01935  
dethiobiotin synthetase [EC:6.3.3.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0733 (bioD)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     NMB0733 (bioD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
764895..765542
Genome map
AA seq 215 aa AA seqDB search
MKGVYFVSGIDTDIGKTVATGVLAKQLLQQGKSVITQKPVQTGCQNIADDIAVHRKIMGI
PMQEADKRRLTMPEIFSYPASPHLAARLDGRALDLDKIRTATQELAAQYEVVLVEGAGGL
MVPLTENLLTIDYIRQQGYPVILVTSGRLGSINHTLLSFAALKQYGIRLHSLVFNHIHDS
RDAHIAQDSLSYLKCRLKADFSEAEWMELAKTDAV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgtttacttcgtcagcggcatagacacggacatcggcaaaaccgtcgccacc
ggcgtgttggcaaaacaattgttgcagcagggcaaaagcgtgattacgcaaaagcccgtg
caaaccggttgccaaaacattgccgacgacatcgccgtccaccgcaaaattatgggcata
ccgatgcaggaagccgacaaacggcggctgactatgcccgaaatcttcagctatcccgct
tcgcctcacctcgccgcccgactggatggcagggctttggacttggacaaaatccgcacc
gccacacaagaattggcggcgcagtacgaagtcgttttggtcgaaggcgcgggcggattg
atggttccgctgacggaaaacctgttaaccattgattatatccgtcagcaaggctatccc
gtcatcctcgttaccagcggacggctcggcagtatcaaccacactttactcagtttcgcc
gcgctcaaacaatacggcattcgcttgcacagcctcgtgttcaaccacatccacgacagc
cgcgacgcacacatcgcccaagacagcctgagctacttgaaatgccgtctgaaagccgat
ttttccgaagcggaatggatggagttggcaaaaacagacgcggtataa

DBGET integrated database retrieval system