KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0734Help
Entry
NMB0734           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K03181  
chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB0734
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     NMB0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
765557..766033
Genome map
AA seq 158 aa AA seqDB search
MEHLFGKWLPDLPAAISDGISLPMVRLLHTRSLTAALRALPHTFSVELLKLGELETECGG
RLVREVLLKLDRIPVVEARSECRIGSAFWQNILDCGTRPLGERLFQADLEGARSAFEFAV
AGEGCGRYFAARRSRFSRHGEEMLLTEYFLPELKRFIG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaacacctatttgggaaatggctgcccgacttgcccgccgccatttcagacggcatc
agcctgccgatggtgcggctgctgcacacccggtcgctgaccgccgcattgcgcgccttg
ccgcatacattttcggtggaactgctgaaactgggcgaattggagacggaatgcggaggg
aggctggtgcgcgaagttttgttgaagctggaccgtatccctgttgttgaggcaaggagc
gaatgccgtatcggttcggcgttttggcaaaacattttggactgcggcacgcgtcctttg
ggcgagcgtctgtttcaagccgatttggaaggggcgcgttcggcgtttgagtttgccgtt
gccggcgaaggatgcggacggtactttgccgcgcggcgttctcggttttcccgtcacggc
gaggaaatgctgctgaccgagtattttctgcccgaactgaaacgttttatcggataa

DBGET integrated database retrieval system